SUMO8

Putative small ubiquitin-related modifier 8

97 amino acids

Ubiquitin-like protein which can be covalently attached to target lysines as a monomer. Does not seem to be involved in protein degradation and may function as an antagonist of ubiquitin in the degradation process (By similarity).

Belongs to the ubiquitin family. SUMO subfamily.

11.263 kDa

MSSSDKKPLIPSSHITVKVKNQDDICVYFRIKRDVELRKMMHAYSDKVGVEMSTLRFLFDGNRIKLNQTPNELGLEDEDEIEAFGEQLGGFSFFHRH