STPG4

Protein STPG4

248 amino acids

Maternal factor that plays a role in epigenetic chromatin reprogramming during early development of the zygote. Involved in the regulation of gametic DNA demethylation by inducing the conversion of the modified genomic base 5-methylcytosine (5mC) into 5-hydroxymethylcytosine (5hmC).

27.807 kDa

MDQPAVATASTSIREDLVGGESFITASKPAQKTSSFEREGWWRIALTDTPIPGTYHLKTFIEESLLNPVIATYNFKNEGRKKPPLVQRNNPVLNDLPQYMPPDFLDLLKKQVATYSFKDKPRPSPSTLVDKDQSLQLSPGQYNVLPAPVPKYASRSCVFRSTVQRFPTTYFIPHEGPGPGHYNVKMPPTSSVTSCFQSRVPRFLPSCSKTPGPGAYTTLRQFPKQSPTIAKMGQEHSLFFNNNNWLLK

Stpg4

Protein STPG4

247 amino acids

Maternal factor that plays a role in epigenetic chromatin reprogramming during early development of the zygote (PubMed:23560077). Involved in the regulation of gametic DNA demethylation by inducing the conversion of the modified genomic base 5-methylcytosine (5mC) into 5-hydroxymethylcytosine (5hmC) (PubMed:23560077).

27.632 kDa

MAEPTVVIAPTTVPREDLGHGEPLLMTAKQVKKTPGLEREGWWRLTITDTPIPGTYHFRTFTEEALLNPVKITYNFKNEGRKKLPLVLRNDPVPTDLPQYSPPDFLELLKKQTASYSFKDKPRADPSTLVDKDESLHLCPGQYEVLPAPVPKSPARSFVFRSSVQRFPPNYFTPHEGPGPGDYELKASPKGSITSCFRSKVPRFLPVSSKTPGPGAYTSSRQFPKQSSTIAKMGREHSLFFNNTIGF