Function
Transcription factor that activates genes required for degradation of extracellular protein and uptake of peptides such as the secreted aspartyl protease SAP2 or the oligopeptide transporter OPT1. Required for virulence. Synthesized as latent cytoplasmic precursor, which, upon a signal initiated by the plasma membrane SPS amino acid sensor system (including CSY1 and CSH3), becomes proteolytically activated and relocates to the nucleus, where it induces the expression of SPS-sensor-regulated genes.
Sequence
MLILSIGLIHHTSNKSLYTISPNKGKRYEPFTTTSLGNFQFHVVRFLHRLIYGTQRYQELFPPIQKIKNINNVKQQRIFPVNCAADDLDLGFGESDQIELFNHPSKDTYGQFNLIQLIDIFDPPQVHAPSSADEFFKSNKGSEHIDIFDMITRQPPPFHQHQLNIETPYFEDFATPLVLPPHEVSSDDVESYFSGSVSTVSSIEPLDDEFVPPPQPPRTHTSRKRKHDSISPPASSDSSSSSSYVPQLIPSSSSSVTSNGDSPVSPTTKRKYTKKKQPVFSNVDEPIVITTTTKTNNIDVKKITTTKNGTVENRFDCPSCDASFKVKGYLTRHLKKHSTSKAFECPFFDNHGVHGSKCHPTGGFSRRDTFKVHLRALHFIYPAGVKASQRNSFNGRCAGCFQYFDNNSEWLENHIEAGKCTGTVQYKQNVSNLLLD