SSU1

Sulfite efflux pump SSU1

481 amino acids

Sulfite efflux pump required for the secretion of sulfite as a reducing agent (By similarity). Plays a role in resistance to neutrophils during infection. Involved in transition to filamentous growth, which is believed to be central to the virulence of this human pathogen.

Belongs to the tellurite-resistance/dicarboxylate transporter (TDT) family.

54.203 kDa

MSSSSHNDNKIPPEKTTTPPLSSSNEDIYNPADSSNVLSSNQTLVSTNNNNNNNQNNNQNNNQNNDGKDTMDHLSYLSTIDSKRREQSYLKSFYQRFIIEDVVKNFTPAYFVSVMGTGISSSLLYNFPFPAYWLQICGYVMFGLTCTFFIGNIILLIMSCAYYPNRFRDYHVDPSRAVFMGAFSMGYITIVNFIALITKGEHIYFVWTLWWLAVFSAMYTSFLIVYLSFMSKLNESDVEAKLNATLLLPIVAITVVSSSGHSIELDLPHVHQTVLTMIVSFMLWSLSISMAFMVMTLYMGRLIIHKIPPTNLIMTSFLPVGFLGQSSYSIYLFGNNLNKFIPEELLYGKISLCLSGFVSVFLLSFGYFMCFVAVTSVLSKIRPFAKNPNPSHTNRFGLLKLEKSFWSMTFPMGTMSLSNTEIGHGGVGNYPLLTFKVMGSIFAAACIFITVGCSIGVVVYSFKKLREDMTNKNKYRNESMV

SSU1

Sulfite efflux pump SSU1

458 amino acids

Involved in efflux of free sulfite. Mutations in the SSU1 gene cause sensitivity to sulfite.

Belongs to the tellurite-resistance/dicarboxylate transporter (TDT) family.

52.545 kDa

MVANWVLALTRQFDPFMFMMVMGVGISSNILYSFPYPARWLRICSYIMFAIACLIFIAVQALQILHLIVYIKEKSFREYFNDFFRNMKHNLFWGTYPMGLVTIINFLGALSKANTTKSPTNARNLMIFVYVLWWYDLAVCLVIAWGISFLIWHDYYPLEGIGNYPSYNIKMASENMKSVLLLDIIPLVVVASSCGTFTMSEIFFHAFNRNIQLITLVICALTWLHAIIFVFILIAIYFWSLYINKIPPMTQVFTLFLLLGPMGQGSFGVLLLTDNIKKYAGKYYPTDNITREQEILTIAVPWCFKILGMVSAMALLAMGYFFTVISVVSILSYYNKKEIENETGKVKRVYTFHKGFWGMTFPMGTMSLGNEELYVQYNQYVPLYAFRVLGTIYGGVCVCWSILCLLCTLHEYSKKMLHAARKSSLFSESGTEKTTVSPYNSIESVEESNSALDFTRLA

SSU1

Sulfite efflux pump SSU1

375 amino acids

Sulphite efflux pump required for the secretion of sulphite as a reducing agent. In the presence of sulphite, cystine in keratin is directly cleaved to cysteine and S-sulphocysteine, and thereby, reduced proteins become accessible to hydrolysis by a variety of secreted endo- and exoproteases. Excretion of sulphite mediated by an efflux pump represents also an detoxification pathway for dermatophytes during infection of the epidermal stratum corneum, hair and nails, which are rich in cysteine.

Belongs to the tellurite-resistance/dicarboxylate transporter (TDT) family.

41.844 kDa

MPSGSGFHNIEEAGEKARKRDDWIAISNFHPGWFSVNMGTGITAILLQNLPYQFPGLHYIAVILFILNVIIFFLFLTISITRYCLWPDKFKAMLAHPAHSMLLGTFPMGFATIINCIVFICVPVWGEWASRFAWGLWWIDAAVSVAICYFVPFMLMTKHTSSLETMTAAWLLPIVAPVVAAASGGVVADSLQNDTHALITILVCYVMWGSAVPLAMVILVIYFQRLAIHKLVPRAAIVSALLPIGPLGQGGFGLMQLGVVAKRVFPRLDFLAPIAGDIFYVMGAFIAMIMWGFGLIWLWFALASFTRGKFYFNIGWWAFTFPLGVFTTATTQMGKEFNSPFFDILGTFFSIVVTCMWVLVFALTVYKSCTKELFR

SSU1

Sulfite efflux pump SSU1

375 amino acids

Sulphite efflux pump required for the secretion of sulphite as a reducing agent. In the presence of sulphite, cystine in keratin is directly cleaved to cysteine and S-sulphocysteine, and thereby, reduced proteins become accessible to hydrolysis by a variety of secreted endo- and exoproteases. Excretion of sulphite mediated by an efflux pump represents also an detoxification pathway for dermatophytes during infection of the epidermal stratum corneum, hair and nails, which are rich in cysteine (By similarity).

Belongs to the tellurite-resistance/dicarboxylate transporter (TDT) family.

41.759 kDa

MPSGSGFQNIEEAGEKARRRDDWIAISNFHPGWFSVNMGTGITAILLQNLPYQFPGLHYIAVVLFVLNVIIFFFFLTISITRYALWPEKFKAMLAHPAHSMLLGTFPMGFATIINCIIFICVPVWGDWAARFAWGLWWVDATVSIAICYFVPFMLMTKHTSSLETMTAAWLLPIVAPVVAAASGGVVADALKNDTHALITILVCYVMWGSAVPLAMVILVIYFQRLALHKLVPRAAIVSALLPIGPLGQGGFGLMQLGVVARRVFPRLDFLAPIAGEIFYVMGAFIAMIMWGFGLIWLWFALASFTRGKFYFNIGWWAFTFPLGVFTTATTQMGKEFNSVVFDVLGTFFSIVVAAMWVMVFALTVYKSCTKELFK

SSU1

Sulfite efflux pump SSU1

375 amino acids

Sulphite efflux pump required for the secretion of sulphite as a reducing agent. In the presence of sulphite, cystine in keratin is directly cleaved to cysteine and S-sulphocysteine, and thereby, reduced proteins become accessible to hydrolysis by a variety of secreted endo- and exoproteases. Excretion of sulphite mediated by an efflux pump represents also an detoxification pathway for dermatophytes during infection of the epidermal stratum corneum, hair and nails, which are rich in cysteine.

Belongs to the tellurite-resistance/dicarboxylate transporter (TDT) family.

41.802 kDa

MPSGSGFHNIEEAGEKARKRDDWIAISNFHPGWFSVNMGTGITAILLQNLPYQFPGLHYIAVVLFILNVIIFFLFLTISITRYCLWPDKFKAMLAHPAHSMLLGTFPMGFATIINCIVFICVPVWGEWASRFAWGLWWIDAAVSVAICYFVPFMLMTKHTSSLETMTAAWLLPIVAPVVAAASGGVVADSLQNDTHALITILVCYAMWGSAVPLAMVILVIYFQRLAIHKLVPRAAIVSALLPIGPLGQGGFGLMQLGVVAKRVFPRLDFLAPIAGDIFYVMGAFIAMIMWGFGLIWLWFALASFTRGKFYFNIGWWAFTFPLGVFTTATTQMGKEFNSPFFDILGTFFSIVVTCMWVLVFALTVYKSCTKELFR

SSU1

Ribulose bisphosphate carboxylase small chain SSU1, chloroplastic

173 amino acids

RuBisCO catalyzes two reactions: the carboxylation of D-ribulose 1,5-bisphosphate, the primary event in carbon dioxide fixation, as well as the oxidative fragmentation of the pentose substrate. Both reactions occur simultaneously and in competition at the same active site (By similarity).

Belongs to the RuBisCO small chain family.

19.522 kDa

MMVSTAAVARVRPAQTNMVGAFNGCRSSVAFPATRKANNDLSTLPSSGGRVSCMQVWPPEGLKKFETLSYLPPLSVEDLAKEVDYLLRNDWVPCIEFSKEGFVYRENNASPGYYDGRYWTMWKLPMFGCTDASQVIAEVEEAKKAYPEYFVRIIGFDNKRQVQCISFIAYKPT