SSQG_00965

(-)-alpha-amorphene synthase ((2E,6E)-farnesyl diphosphate cyclizing)

338 amino acids

Catalyzes the conversion of (2E,6E)-farnesyl diphosphate (FPP) to yield the bicyclic sesquiterpene (1R,6S,7S)-(-)-alpha-amorphene via a probable 1,6-cyclization, which could involve the abstraction of the pyrophosphate from FPP to yield a (R)-bisabolyl cation (PubMed:23307484, PubMed:27666571, PubMed:27829890). The only accepted substrate is (2E,6E)-farnesyl diphosphate (FPP) (PubMed:27829890).

Belongs to the terpene synthase family.

37.003 kDa

MAKMSTTHEEIALAGPDGIPAVDLRDLIDAQLYMPFPFERNPHASEAAAGVDHWLSTWGLTDDPAVAAMISCTRPAELAAFNGPDMDSGLLQIAANQIAYQFVFDDRAEDIGRHSPGRLLPMLSESVAILRDGQPPTTPLGAALADLHRQVQERCTPAQAARWAWNSREYVHGLLYEAVAQAHPAPVESGLCRSIRSLIAGVEPFYPLCEAAQRCELAPEELHHPAMRRLSRLSADAAVWIPDLFSAVKEQRAGGMINLALAYRRTHRCSLPAAVTLAVRHINSTIREFEDLYGEVRPELSPSGIGYVEGMAGWIRGCYFWSRTVPRYADTLTAPAGL