SSN8

RNA polymerase II holoenzyme cyclin-like subunit

434 amino acids

Component of the SRB8-11 complex. The SRB8-11 complex is a regulatory module of the Mediator complex which is itself involved in regulation of basal and activated RNA polymerase II-dependent transcription. The SRB8-11 complex may be involved in the transcriptional repression of a subset of genes regulated by Mediator. It may inhibit the association of the Mediator complex with RNA polymerase II to form the holoenzyme complex. The SRB8-11 complex phosphorylates the C-terminal domain (CTD) of the largest subunit of RNA polymerase II (By similarity).

Belongs to the cyclin family. Cyclin C subfamily.

50.364 kDa

MSADYWNSSQRNQWQLTRFSLLEARRRVLLLERKMIQNGLIKDYPNIIYDYNMRIYLHNLLIKLGRRLNIRQIALATAEIYLTRFLTRVSLKEINVYLLITTCIYVACKIEECPQHIRLILSEARNIWPEYIPHDVTKLAEFEFYLIEEMDSYLLLHHPYKSLMQINEFLSNNYNVFGFKLTVEELQNAWSLINDSYITDLHLLLPPHTIAVAAIYITVVLKKNLSRVRQGNNNDNNININTMHISTGSSTNPININNNNNTNTSNNNGTTSTTTTTTAQETQVLGQDDNTEMNIDDLMNLTKSSNNSQDKSDDKMDIDNPLQSQVNLSQIQNQTQHQHQESTHNNTSSTNTGRNGINGQISQSNQELNNFDLDILDEDTIKINKFMNFLEHSHINLDEVVEAVQDMMNMYVLWNRYNEQGVKKALQVMLLNRI

SSN8

RNA polymerase II holoenzyme cyclin-like subunit

393 amino acids

Component of the SRB8-11 complex. The SRB8-11 complex is a regulatory module of the Mediator complex which is itself involved in regulation of basal and activated RNA polymerase II-dependent transcription. The SRB8-11 complex may be involved in the transcriptional repression of a subset of genes regulated by Mediator. It may inhibit the association of the Mediator complex with RNA polymerase II to form the holoenzyme complex. The SRB8-11 complex phosphorylates the C-terminal domain (CTD) of the largest subunit of RNA polymerase II (By similarity).

Belongs to the cyclin family. Cyclin C subfamily.

43.478 kDa

MSANYWASTQCNNWLLDRPQLELARKEDLRYATRLECAALGVFFSNLLSLICKRLNLRQRVTASANVFFRRFFAKNSYSALDPFLVCATCVYVAAKVEESPIHIKSAVAEATRSFTEHGFRGMPTDHSSLAEMEFYLLEEMEFDMVLFHSYRSLIVMFEDYGSGSAVGSGNSIHERSAGAAGSGSGSGGSGMMIGLGIEAAAFGVTKGLASVEEGDAASAIAEEDKVQLNEFNDEVLLMCWFILNDTYKTDIPLMYPPYMVALASIWLGLSLHPPSFDKITASLHTMQTRRDEHHLSIQRILDNPASTPAELASAKREPSPPSQDALTFFASLNVSLPLLAEIVQEMVSAYSVQHQVQRLVSDGPGIVKLLERMRESRRVALIKDRDQTRTHA

SSN8

RNA polymerase II holoenzyme cyclin-like subunit

364 amino acids

Component of the SRB8-11 complex. The SRB8-11 complex is a regulatory module of the Mediator complex which is itself involved in regulation of basal and activated RNA polymerase II-dependent transcription. The SRB8-11 complex may be involved in the transcriptional repression of a subset of genes regulated by Mediator. It may inhibit the association of the Mediator complex with RNA polymerase II to form the holoenzyme complex. The SRB8-11 complex phosphorylates the C-terminal domain (CTD) of the largest subunit of RNA polymerase II (By similarity).

Belongs to the cyclin family. Cyclin C subfamily.

39.849 kDa

MAANYWESTQRKHWQFTKQDLAAIRQRLDDEDPGLVQMFPLPQLRHLNIYFNQQINRLSKRIGLRQQVMATAQVYLKRFYTRIAIRQTNPYLVLTTVLYLACKMEECPQHIRMMTQEARSLWPSDLHGHDPARVGECEFSLISEMHSNLIVHQPYRSLLGVQDEFGLTQDEMSLAWTVINDHYMTDLPLLHPPHVVALTAVLLALVLRPSANTPAAGGAGGNAGAAAAAAAAGAGGVAMAATALAQAQAQVQARAAAIAAAGAGGGTPGFGSQGSQQQAGFSQGNSQGSLQGDSAAAEPKKVTDPRLAKVQRFAAWLADSNIDIEAMVDCTQELISFYECHEQYNDKHTKEQISRFIKARNLDK

SSN8

RNA polymerase II holoenzyme cyclin-like subunit

363 amino acids

Component of the SRB8-11 complex. The SRB8-11 complex is a regulatory module of the Mediator complex which is itself involved in regulation of basal and activated RNA polymerase II-dependent transcription. The SRB8-11 complex may be involved in the transcriptional repression of a subset of genes regulated by Mediator. It may inhibit the association of the Mediator complex with RNA polymerase II to form the holoenzyme complex. The SRB8-11 complex phosphorylates the C-terminal domain (CTD) of the largest subunit of RNA polymerase II (By similarity).

Belongs to the cyclin family. Cyclin C subfamily.

41.256 kDa

MAANFWESTQRRNWLFTKEELAARRQQLENEDPSLVTMYPLPEWRHLYNYFNYQMLRLAKNLSIRQQAIATAQVYMKRFYTRVEIRSTNPTLVLVTAVYLACKMEEMPLHIRNVSLEAKKVWPMETPSLEIAKIGECEFWLISEMSAQLIVHQPYRTLTALQQDFQLANDDHVLAVSFLNDHFMTDLPLLYAPHTIALAAIMLALVLRLSKASSSNNAAAGQQGGAQAGPLGITLASGLSMFQQAVAAKAMTPGGSGSPAMSSPIQQNPPNQAYQLTPQQQEMFRQQQMQQQNRQPETQAKDSPQKEKSKLQRFAAWLSESGVDIEAMIDCTQELIAFYECQESYNEQITRDQINRFVKARGL

SSN8

RNA polymerase II holoenzyme cyclin-like subunit

346 amino acids

Component of the SRB8-11 complex. The SRB8-11 complex is a regulatory module of the Mediator complex which is itself involved in regulation of basal and activated RNA polymerase II-dependent transcription. The SRB8-11 complex may be involved in the transcriptional repression of a subset of genes regulated by Mediator. It may inhibit the association of the Mediator complex with RNA polymerase II to form the holoenzyme complex. The SRB8-11 complex phosphorylates the C-terminal domain (CTD) of the largest subunit of RNA polymerase II (By similarity).

Belongs to the cyclin family. Cyclin C subfamily.

40.545 kDa

MSADFWCSSQRNKWQLSRQSLLEARRKVLLLERKMIQNGLIKDYPNIHYDFNMRIYLHNLLIKLGRRLNIRQVALATAEIYLNRFLTRVSLKEINVYLLVTTCLYVACKIEECPQHIRLIISEARNLWPEYIPHDVTKLAEFEFYLIEEMDSYLFLHHPYKSLIQIRDFLNENSAVFGFTLTDDELQNAWSLVNDSYITDLHLLLPPHIIAVASIYITIVLKKNLSAIRVNSSAVNSNGGPNSMMFNRNPDQNSMHIDDLMILANPSTPGSDLVNNLERTNFHDMKLDEETIKINKFMNFLDHSHINLDEVVEAMQDMINIYVQWNRYNEQGVKKALQVMLLNRQL

SSN8

RNA polymerase II holoenzyme cyclin-like subunit

345 amino acids

Component of the SRB8-11 complex. The SRB8-11 complex is a regulatory module of the Mediator complex which is itself involved in regulation of basal and activated RNA polymerase II-dependent transcription. The SRB8-11 complex may be involved in the transcriptional repression of a subset of genes regulated by Mediator. It may inhibit the association of the Mediator complex with RNA polymerase II to form the holoenzyme complex. The SRB8-11 complex phosphorylates the C-terminal domain (CTD) of the largest subunit of RNA polymerase II (By similarity).

Belongs to the cyclin family. Cyclin C subfamily.

39.838 kDa

MSADFWSSSQRNRWQLTRHSLLESRRKLLLLEKKMIQNGFIKDYPNVEYDANTRIYLHNLLIKLGRRLNVRQIALATAEIYMSRFLIKVSLKEINVYLLVTTCLYAACKIEECPQHIRLITSEARNLWPEYIPQDVTKLAEFEFYLIEEMDSFLVLHHPYRSLLQIRDYLNENFALYGFSLSDDELQNSWSLINDSYITDLHLLLPPHIIAIATIYITIVLKKNISSLRLGANSMSNDTVGMDPHTKPNSNSIHAEDLMALATGGSAINDIGNPSSGTNGFHDIELDENTIKINKFMTFLDHSHVNLNEVVEAIQDIITLYAIWNRYNEMSVKKVLQDMLLNRSV

ssn8

RNA polymerase II holoenzyme cyclin-like subunit

345 amino acids

Component of the srb8-11 complex. The srb8-11 complex is a regulatory module of the Mediator complex which is itself involved in regulation of basal and activated RNA polymerase II-dependent transcription. The srb8-11 complex may be involved in the transcriptional repression of a subset of genes regulated by Mediator. It may inhibit the association of the Mediator complex with RNA polymerase II to form the holoenzyme complex. The srb8-11 complex phosphorylates the C-terminal domain (CTD) of the largest subunit of RNA polymerase II (By similarity).

Belongs to the cyclin family. Cyclin C subfamily.

38.472 kDa

MAANYWESTQRKHWLFTKDELAAMRAKLEAEEPNLVASFPLPQLRHLNIYFNQQINRLGKRMGLRQQALATAQVYIKRFYTKVEIRRTNPHHVLVTALYLACKMEECPQHIRLMANEARGFWPTDFQSQTEVARIGECEFYLISEMSSHLIVHSPYRTLTSLQGELGLAQEDVNLAWSVINDHYMTDLPLLHPPHVIALTAILLALVLRQDPSGRLPGTAASASGLVAASAALAQAQAQAQARAAMMAGGGQTVPGLTPQSSSGLQAMLPPQSPAGEGPAEGNKNPRMAKVHRFAAWLSDSNIDIEAMVDCTQELISFYECHEQYNDKNTREQINRFVKARGLDK

SSN8

RNA polymerase II holoenzyme cyclin-like subunit

339 amino acids

Component of the SRB8-11 complex. The SRB8-11 complex is a regulatory module of the Mediator complex which is itself involved in regulation of basal and activated RNA polymerase II-dependent transcription. The SRB8-11 complex may be involved in the transcriptional repression of a subset of genes regulated by Mediator. It may inhibit the association of the Mediator complex with RNA polymerase II to form the holoenzyme complex. The SRB8-11 complex phosphorylates the C-terminal domain (CTD) of the largest subunit of RNA polymerase II (By similarity).

Belongs to the cyclin family. Cyclin C subfamily.

39.489 kDa

MSGSYWTSMQRQKWQHTKPSLARERQRLWVMECQLFPQGLNIIVDSKPNSADSSNGNAANNGGGNGRSQLVATTKNIPITHRDLHYDKDYNLRIYCYFLIMKLGRRLNIRQYALATAHIYLSRFLLKASVREVNLYLLVTTCVYLACKVEECPQYIRTLVSEARSLWPEFIPPDPTKVTEFEFYLIEELQCYLIVHHPYKSMEQIVEALKEEPFKLTFTSDELQNCWSLINDSFINDVHLTYAPHIIAMACLFITVSIQGSNTKELSLTSAVTETLTSQSSLTPQQQTFFRFLAESHVDLEEVMDTIQQQIILYDHWDRYHEPWIKYLLHTLYLRPLSA

SSN8

RNA polymerase II holoenzyme cyclin-like subunit

332 amino acids

Component of the SRB8-11 complex. The SRB8-11 complex is a regulatory module of the Mediator complex which is itself involved in regulation of basal and activated RNA polymerase II-dependent transcription. The SRB8-11 complex may be involved in the transcriptional repression of a subset of genes regulated by Mediator. It may inhibit the association of the Mediator complex with RNA polymerase II to form the holoenzyme complex. The SRB8-11 complex phosphorylates the C-terminal domain (CTD) of the largest subunit of RNA polymerase II (By similarity).

Belongs to the cyclin family. Cyclin C subfamily.

38.204 kDa

MSASYWDSSQRNKWQYSRESLARTRQKLWMLECQLYPQGTNILMEGGGKDAQPVTKNIPITHRDLHYDRDYNLRIYCYFLIMKLGRRLNVRQYALATAHVYLARFCLKASIREVNLYLLVTTCIYLACKVEECPQHIRTLVNEARSLWPEFVPPDPTKVTEFEFYLIEELQSYMIVHYPYRAMEQIAAALRRPPYNLVLSPDDLQNSWSLINDSYITDVHLLYPPHVIAMACLFITVCLRSAAGARDLQETFNRFMADSQVDLHEVMDTIQDFITLYDHWDKYNEPWIKFLLHNLYLRPHAGGTTVSGAAAGSAGPAGSVLTPNGTITGSTS

SSN8

RNA polymerase II holoenzyme cyclin-like subunit

323 amino acids

Component of the SRB8-11 complex. The SRB8-11 complex is a regulatory module of the Mediator complex which is itself involved in regulation of basal and activated RNA polymerase II-dependent transcription. The SRB8-11 complex may be involved in the transcriptional repression of a subset of genes regulated by Mediator. It may inhibit the association of the Mediator complex with RNA polymerase II to form the holoenzyme complex. The SRB8-11 complex phosphorylates the C-terminal domain (CTD) of the largest subunit of RNA polymerase II RPB1 at serines 2 and 5. The SSN3/SRB10 and SSN8/SRB11 kinase-cyclin pair may also positively and negatively regulate numerous transcriptional activators in response to changes in nutritional and physiological conditions.

Belongs to the cyclin family. Cyclin C subfamily.

37.791 kDa

MSGSFWTSTQRHHWQYTKASLAKERQKLWLLECQLFPQGLNIVMDSKQNGIEQSITKNIPITHRDLHYDKDYNLRIYCYFLIMKLGRRLNIRQYALATAHIYLSRFLIKASVREINLYMLVTTCVYLACKVEECPQYIRTLVSEARTLWPEFIPPDPTKVTEFEFYLLEELESYLIVHHPYQSLKQIVQVLKQPPFQITLSSDDLQNCWSLINDSYINDVHLLYPPHIIAVACLFITISIHGKPTKGSSLASAASEAIRDPKNSSSPVQIAFNRFMAESLVDLEEVMDTIQEQITLYDHWDKYHEQWIKFLLHTLYLRPASAI

SSN8

RNA polymerase II holoenzyme cyclin-like subunit

319 amino acids

Component of the SRB8-11 complex. The SRB8-11 complex is a regulatory module of the Mediator complex which is itself involved in regulation of basal and activated RNA polymerase II-dependent transcription. The SRB8-11 complex may be involved in the transcriptional repression of a subset of genes regulated by Mediator. It may inhibit the association of the Mediator complex with RNA polymerase II to form the holoenzyme complex. The SRB8-11 complex phosphorylates the C-terminal domain (CTD) of the largest subunit of RNA polymerase II (By similarity). May play a role in signal transduction pathways regulating secondary metabolism and fungal development (conidiation).

Belongs to the cyclin family. Cyclin C subfamily.

36.714 kDa

MSANYWHSTQCRFWSFTKEQLVTMRQKLEEDNAELVRMFPLPQQRRLYIYFNQQLIRLAKRLTIRQQSMATAQVYMKRFYSKVEIRRTNPYLVIATAIYLACKIEESPQHIRLIVTEARQMWGDLVAIDTSKLGECEFFMISEMRSQLIVFQPYRTITALRNELSLVDDEVQLARSVINDHFMTDLPLLYPPHIIAMVAILLALVLRPNNSGPGQSTSGAAAAAGLAAAQQALMRAQGQQAQGGMPEPAAAEPKEKRQQDRVSRVQKFAKWLVDSNVEIASMVDATQEIISFYECYEHYNDKLTREQINRFVKARGLDK

SSN8

RNA polymerase II holoenzyme cyclin-like subunit

304 amino acids

Component of the SRB8-11 complex. The SRB8-11 complex is a regulatory module of the Mediator complex which is itself involved in regulation of basal and activated RNA polymerase II-dependent transcription. The SRB8-11 complex may be involved in the transcriptional repression of a subset of genes regulated by Mediator. It may inhibit the association of the Mediator complex with RNA polymerase II to form the holoenzyme complex. The SRB8-11 complex phosphorylates the C-terminal domain (CTD) of the largest subunit of RNA polymerase II (By similarity).

Belongs to the cyclin family. Cyclin C subfamily.

36.183 kDa

MSASYWDSSQRHKWKYTRESLAKEKQKLWLLECQLFPQGLNVTIHDSKANKQVTTNIPVTQRDLHYDRDYNLRIYCYFLIMKLGRRLNIRQCALVTAHVYLSRFLLRASVREVNLYLLITTCIYLACKVEECPQHIRTLVNEARSLWPEFIPPDVTKVTEFEFYLIEELQSYLIVHHPYRSLEQIEKALSSEKYNYKLSDDELQKIWSLINDSYTTDVHLLYSPHVIAISCLFAVSCIIHKPEDSTKRANINMFIAETQVNLEQVMFILQELISLYDHWDKYNELRIRALLHELYLRQQTPAIQ

SSN8

RNA polymerase II holoenzyme cyclin-like subunit

303 amino acids

Component of the SRB8-11 complex. The SRB8-11 complex is a regulatory module of the Mediator complex which is itself involved in regulation of basal and activated RNA polymerase II-dependent transcription. The SRB8-11 complex may be involved in the transcriptional repression of a subset of genes regulated by Mediator. It may inhibit the association of the Mediator complex with RNA polymerase II to form the holoenzyme complex. The SRB8-11 complex phosphorylates the C-terminal domain (CTD) of the largest subunit of RNA polymerase II (By similarity).

Belongs to the cyclin family. Cyclin C subfamily.

34.517 kDa

MAADYWSSTQHQSWLFGREELAEARKVLGDAERPFIQQYPLPDLRLFNIYVNQQLIKLAKRLNVRQQALATAQVYVKRFYTKVEIRRTNPYLVLTTAFYLACKIEECPQHIRLVLGEARGLWPEFIAPDSAKIGECEFWLISEMNSQLIVHHPYRTLSELQSYLSLTSDEIALAWSVINDHYLTDLLLLHPPHVISVMAIFIAVVFKPNQHQVVSISGGSSATGALRDGSTNILSAFNDKTGAGMPAKVQRIVDWLANSDINIEAVIECTQDIVSLYEVWEQYSEKVCKEQIGRYVKSRGLDK

ssn8

RNA polymerase II holoenzyme cyclin-like subunit

302 amino acids

Component of the srb8-11 complex. The srb8-11 complex is a regulatory module of the Mediator complex which is itself involved in regulation of basal and activated RNA polymerase II-dependent transcription. The srb8-11 complex may be involved in the transcriptional repression of a subset of genes regulated by Mediator. It may inhibit the association of the Mediator complex with RNA polymerase II to form the holoenzyme complex. The srb8-11 complex phosphorylates the C-terminal domain (CTD) of the largest subunit of RNA polymerase II (By similarity).

Belongs to the cyclin family. Cyclin C subfamily.

34.533 kDa

MAANYWASTQRRHWLFTRERLAEIREAFRERHKLAHSQFPLPDQRLLNIYFSQQLIKLGKRMSTRQQALATAQVYIKRFYTKNEIRHTNPYLVLTTAFYLACKMEECPQHIRFVVGEARSLWPEFITPDVSKLGECEFSLISEMNSQLIVHHPYRTLSGLQSELSLTSDEVALAWSVINDHYLTDLPLLYSPHVIAVMAVMVAVVFKPGPGNFHGSAAPVLAGAMRDGGMNMLAALGDKSGNEPPPKVQKLINWLAESEVDIKAVIECTQELVSLYEVWEQYSEKNCKELLGRMVKTKHLDK

ssn8

RNA polymerase II holoenzyme cyclin-like subunit

302 amino acids

Component of the srb8-11 complex. The srb8-11 complex is a regulatory module of the Mediator complex which is itself involved in regulation of basal and activated RNA polymerase II-dependent transcription. The srb8-11 complex may be involved in the transcriptional repression of a subset of genes regulated by Mediator. It may inhibit the association of the Mediator complex with RNA polymerase II to form the holoenzyme complex. The srb8-11 complex phosphorylates the C-terminal domain (CTD) of the largest subunit of RNA polymerase II (By similarity).

Belongs to the cyclin family. Cyclin C subfamily.

34.382 kDa

MAANYWASTQRRHWLFTREKLAEIREIFREGDKVAHSQFPLPDQRLLNIYFSQQLIKLGKRMSTRQQALATAQVYIKRFYTKNEIRHTNPYLVLTTAFYLACKMEECPQHIRFVVGEARSLWPEFITPDVSKLGECEFSLISEMNSQLIVHHPYRTLSELQPELSLTSDEVALAWSVINDHYLTDLPLLYAPHVIAVMAIIVAVVFKPNSGNFHGSAAPVLAGAMRDGGMNVLAALGDRTGSGPPLKIQKLINWLAESEVDIKGVIECTQELVSLYEVWEQYSEKTCKELLGRMVKAKNLDK

ssn8

RNA polymerase II holoenzyme cyclin-like subunit

302 amino acids

Component of the srb8-11 complex. The srb8-11 complex is a regulatory module of the Mediator complex which is itself involved in regulation of basal and activated RNA polymerase II-dependent transcription. The srb8-11 complex may be involved in the transcriptional repression of a subset of genes regulated by Mediator. It may inhibit the association of the Mediator complex with RNA polymerase II to form the holoenzyme complex. The srb8-11 complex phosphorylates the C-terminal domain (CTD) of the largest subunit of RNA polymerase II (By similarity).

Belongs to the cyclin family. Cyclin C subfamily.

34.426 kDa

MAANYWASTQRKHWLFTRERLAEIRESFKEKDKASHTHFPLPDQRLLNIYFNQQLIKLGKRMSTRQQALATAQVYIKRYYTKNEIRNTNPYLVLTTAFYLACKMEECPQHIRFVVSEARALWPEFIVPDVSKVGECEFSLISEMQAQLIVHHPYRTLSELQPELSLTSDEVALAWSVINDHYLTDLSLLYPPHIIAVMAIIVAVVFKPSSQTAFHGSAAPIAGAMRDGGMNILAALSDKGGAGPPPRIQKLIAWLAESEVDIKAVIESTQELVSLYEVWEQYSEKNCKELLGRMIRSKSLDK

ssn8

RNA polymerase II holoenzyme cyclin-like subunit

301 amino acids

Component of the srb8-11 complex. The srb8-11 complex is a regulatory module of the Mediator complex which is itself involved in regulation of basal and activated RNA polymerase II-dependent transcription. The srb8-11 complex may be involved in the transcriptional repression of a subset of genes regulated by Mediator. It may inhibit the association of the Mediator complex with RNA polymerase II to form the holoenzyme complex. The srb8-11 complex phosphorylates the C-terminal domain (CTD) of the largest subunit of RNA polymerase II (By similarity).

Belongs to the cyclin family. Cyclin C subfamily.

34.418 kDa

MAANYWASTQRRHWLFTKERLADIRESFRERDKAAHSQFPLPDQRLLNIYFSQQLIKLGKRMSTRQQALATAQVYIKRFYTKNEIRHTNPYLVVTTAFYLACKMEECPQHIRFVVAEARNFWPEFIAPDVSKLGECEFALISEMNSQLIVHHPYRTLSELQPELSLTSDEVALAWSVINDHYLTDLPLLYPPHVIAVMAIIVAVVFKPSQTSFHGTAAPLAGAMRDGGMNILAALGDKNGAGPPPRIQKLVGWLAESEVDIRAVIECTQELVSLYEIWENYSEKHCKELLGRMVKSKNLDK

ssn8

RNA polymerase II holoenzyme cyclin-like subunit

301 amino acids

Component of the srb8-11 complex. The srb8-11 complex is a regulatory module of the Mediator complex which is itself involved in regulation of basal and activated RNA polymerase II-dependent transcription. The srb8-11 complex may be involved in the transcriptional repression of a subset of genes regulated by Mediator. It may inhibit the association of the Mediator complex with RNA polymerase II to form the holoenzyme complex. The srb8-11 complex phosphorylates the C-terminal domain (CTD) of the largest subunit of RNA polymerase II (By similarity).

Belongs to the cyclin family. Cyclin C subfamily.

34.358 kDa

MAANYWVSTQRRHWLFTRERLADIREGFKERDKVAHSQFPLPDQRLLNIYFSQQLIKLGKRTTTRQQALATAQVYIKRFYTKNDIRHTNPYLVITTAFYLACKMEECPQHIRFVVAEARSFWPEFIAPDVSKLGECEFALISEMNSQLIVHHPYRTLSELTPELQLTSDEVALAWSVINDHYLTDLPLLYPPHVIAVMAIIVAVVFKPSQTSFHGSAGPALAGAMRDGGVNLLAALGDKNGNGPPRIQKLVGWLAESEVDIKAVIECTQELVSLYEIWEQYSEKHCKELLGRMVKSKNLDK

SSN8

RNA polymerase II holoenzyme cyclin-like subunit

280 amino acids

Component of the SRB8-11 complex. The SRB8-11 complex is a regulatory module of the Mediator complex which is itself involved in regulation of basal and activated RNA polymerase II-dependent transcription. The SRB8-11 complex may be involved in the transcriptional repression of a subset of genes regulated by Mediator. It may inhibit the association of the Mediator complex with RNA polymerase II to form the holoenzyme complex. The SRB8-11 complex phosphorylates the C-terminal domain (CTD) of the largest subunit of RNA polymerase II (By similarity).

Belongs to the cyclin family. Cyclin C subfamily.

32.469 kDa

MSANYWTSSQRLHWLLTKETLAERRKGLEDIFDPGKLQTIKALNPWHVRVYLHTLIHLLGQNLSIRQRILATAEVYLTRFHTKVPFGEINPYLVVATAVYVACKVEEHPQHIRTITSEARSLWPDYISHDPTKIAECEFYLIEELGTYLVIFHPYKSLMQISDAMARSNAQITMAPEEIQVTWSMINDSYITDLHLLNPPHIVAMACIYMTVVLRSHIMRMTMPSEAVKSRIEAFMTFFGESNVDLEQTIDCVQEMISLYVNWDTYSEKQCRVEIAKVIT