Sprr2e

Small proline-rich protein 2E

76 amino acids

Cross-linked envelope protein of keratinocytes. It is a keratinocyte protein that first appears in the cell cytosol, but ultimately becomes cross-linked to membrane proteins by transglutaminase. All that results in the formation of an insoluble envelope beneath the plasma membrane (By similarity).

Belongs to the cornifin (SPRR) family.

8.406 kDa

MSYQQQQCKQPCQPPPVCPPKKCPEPCPHPQCPEPCPPPKCPEPCPEPCPPPSYQQKCPPVQPPPPCQQKCPPKSK

SPRR2E

Small proline-rich protein 2E

72 amino acids

Cross-linked envelope protein of keratinocytes. It is a keratinocyte protein that first appears in the cell cytosol, but ultimately becomes cross-linked to membrane proteins by transglutaminase. All that results in the formation of an insoluble envelope beneath the plasma membrane.

Belongs to the cornifin (SPRR) family.

7.855 kDa

MSYQQQQCKQPCQPPPVCPTPKCPEPCPPPKCPEPCPPPKCPQPCPPQQCQQKCPPVTPSPPCQPKCPPKSK