SPR1

Sporulation-specific glucan 1,3-beta-glucosidase

445 amino acids

Probably involved in the processes of spore formation and contributes to ascospore thermoresistance by participating in the morphogenesis of ascospore walls. The enzyme may do this by modifying glucan linkages in the developing ascospore wall, thus strengthening it or lending it plasticity (By similarity).

Belongs to the glycosyl hydrolase 5 (cellulase A) family.

51.556 kDa

MVSFKRLTTLALSFTQLVNCNPVSPKSKDSLQFIYKEKANVYSEANSQSIREKIRGVNLGGWLVLEPYITPSIFEAFRTNPHNDNGIPVDEYRFCQSLGYEKAKERLYNHWSTFYKEEDFAKIASQGFNMVRIPVGYWAFTTLSHDPYVTGEQEYFLDKAVDWARKYGLKVWIDLHGAAGSQNGFDNSGLRDSYKFLDEEYLSATMKALTYILSKYSTDIYLDTVIGIELLNEPLGPVFDMERLKNLFLKPAYDYLRNKIMSKQIIVMHDAFQPYNYWDNFLNGDKEEYGVILDHHHYQVFSPIELARNMNERIKIACQWGVGTLSEKHWSVAGEFSAALTDCTKWLNGVGFGARYDGTWAKGNDKSYHIGSCANNENVGLWSEERKQNTRKFIEAQLDAFEMTGGWIMWCYKTENSIEWDVEKLIQHNLFPQPISDRKHPNQCH

SPR1

Sporulation-specific glucan 1,3-beta-glucosidase

445 amino acids

Probably involved in the processes of spore formation and contributes to ascospore thermoresistance by participating in the morphogenesis of ascospore walls. The enzyme may do this by modifying glucan linkages in the developing ascospore wall, thus strengthening it or lending it plasticity.

Belongs to the glycosyl hydrolase 5 (cellulase A) family.

51.809 kDa

MVSFRGLTTLTLLFTKLVNCNPVSTKNRDSIQFIYKEKDSIYSAINNQAINEKIHGVNLGGWLVLEPYITPSLFETFRTNPYNDDGIPVDEYHFCEKLGYEKAKERLYSHWSTFYKEEDFAKIASQGFNLVRIPIGYWAFTTLSHDPYVTAEQEYFLDRAIDWARKYGLKVWIDLHGAAGSQNGFDNSGLRDSYKFLEDENLSATMKALTYILSKYSTDVYLDTVIGIELLNEPLGPVIDMERLKNLLLKPAYDYLRNKINSNQIIVIHDAFQPYHYWDGFLNDEKNEYGVIIDHHHYQVFSQVELTRKMNERIKIACQWGKDAVSEKHWSVAGEFSAALTDCTKWLNGVGLGARYDGSWTKDNEKSHYINTCANNENIALWPEERKQNTRKFIEAQLDAFEMTGGWIMWCYKTENSIEWDVEKLIQLNIFPQPINDRKYPNQCH

SPR1

Protein SPIRAL1

119 amino acids

Required for directional control of cell elongation. Stabilizes growing ends of cortical microtubules and influences their dynamic properties. Acts redundantly with SP1Ls in maintaining the cortical microtubules organization essential for anisotropic cell growth. Plays a key role in salt stress-induced microtubules disassembly.

Belongs to the SPIRAL1 family.

11.92 kDa

MGRGNSCGGGQSSLDYLFGGDAPAPKPVPAPRPAPTESNNGPAPPVTAVTATALTTATTSVEPAELNKQIPAGIKTPVNNYARAEGQNTGNFLTDRPSTKVHAAPGGGSSLDYLFTGGK