Spout1

Putative methyltransferase C9orf114 homolog

385 amino acids

Required for association of the centrosomes with the poles of the bipolar mitotic spindle during metaphase. Also involved in chromosome alignment. May promote centrosome maturation probably by recruiting A-kinase anchor protein AKAP9 to centrosomes in early mitosis. Binds specifically to miRNA MIR145 hairpin, regulates MIR145 expression at a postranscriptional level (By similarity).

Belongs to the class IV-like SAM-binding methyltransferase superfamily.

42.958 kDa

MAERPRKRPCGPGEHGQRVEWRKWKQQKKEEKKKWKDLKIMKKLERQRAQEEEAKRQEEEEEAAAQRSNQGRPYTLSVALPGSILDNAQSPELRTYLAGQIARACTIFCVDEIVVFDEEGQDTKSVEGEFRGVGKKGQACVQLARILQYLECPQYLRKAFFPKHQDLQFAGILNPLDSPHHMRQDEESEFREGVVVDRPTKAGHGSLVNCGMKKEVKIDKKLDPGLRVTVRLNQQQLPECKTYKGTVVSSQDPRTKAGLYWGYTVRLASCLSAVFAEAPFQDGYDLTIGTSERGSDVASAQLPSFRHALVVFGGLQGLEAAVDADPNLEVADPSVLFDFYVNTCLSQGSRTIRTEEAILISLAALQPGLTQVGSRPASPLSGPRM

Spout1

Putative methyltransferase C9orf114 homolog

385 amino acids

Required for association of the centrosomes with the poles of the bipolar mitotic spindle during metaphase. Also involved in chromosome alignment. May promote centrosome maturation probably by recruiting A-kinase anchor protein AKAP9 to centrosomes in early mitosis. Binds specifically to miRNA MIR145 hairpin, regulates MIR145 expression at a postranscriptional level (By similarity).

Belongs to the class IV-like SAM-binding methyltransferase superfamily.

42.958 kDa

MAERPRKRPCGPGEHGQRVEWRKWKQQKKEEKKKWKDLKIMKKLERQRAQEEEAKRQEEEEEAAAQRSNQGRPYTLSVALPGSILDNAQSPELRTYLAGQIARACTIFCVDEIVVFDEEGQDTKSVEGEFRGVGKKGQACVQLARILQYLECPQYLRKAFFPKHQDLQFAGILNPLDSPHHMRQDEESEFREGVVVDRPTKAGHGSLVNCGMKKEVKIDKKLDPGLRVTVRLNQQQLPECKTYKGTVVSSQDPRTKAGLYWGYTVRLASCLSAVFAEAPFQDGYDLTIGTSERGSDVASAQLPSFRHALVVFGGLQGLEAAVDADPNLEVADPSVLFDFYVNTCLSQGSRTIRTEEAILISLAALQPGLTQVGSRPASPLSGPRM

SPOUT1

Putative methyltransferase C9orf114

376 amino acids

Required for association of the centrosomes with the poles of the bipolar mitotic spindle during metaphase (PubMed:20813266, PubMed:25657325). Also involved in chromosome alignment (PubMed:20813266). May promote centrosome maturation probably by recruiting A-kinase anchor protein AKAP9 to centrosomes in early mitosis (PubMed:25657325). Binds specifically to miRNA MIR145 hairpin, regulates MIR145 expression at a postranscriptional level (PubMed:28431233).

Belongs to the class IV-like SAM-binding methyltransferase superfamily.

42.009 kDa

MAERGRKRPCGPGEHGQRIEWRKWKQQKKEEKKKWKDLKLMKKLERQRAQEEQAKRLEEEEAAAEKEDRGRPYTLSVALPGSILDNAQSPELRTYLAGQIARACAIFCVDEIVVFDEEGQDAKTVEGEFTGVGKKGQACVQLARILQYLECPQYLRKAFFPKHQDLQFAGLLNPLDSPHHMRQDEESEFREGIVVDRPTRPGHGSFVNCGMKKEVKIDKNLEPGLRVTVRLNQQQHPDCKTYHGKVVSSQDPRTKAGLYWGYTVRLASCLSAVFAEAPFQDGYDLTIGTSERGSDVASAQLPNFRHALVVFGGLQGLEAGADADPNLEVAEPSVLFDLYVNTCPGQGSRTIRTEEAILISLAALQPGLIQAGARHT

SPOUT1

Putative methyltransferase C9orf114

376 amino acids

Required for association of the centrosomes with the poles of the bipolar mitotic spindle during metaphase (PubMed:20813266, PubMed:25657325). Also involved in chromosome alignment (PubMed:20813266). May promote centrosome maturation probably by recruiting A-kinase anchor protein AKAP9 to centrosomes in early mitosis (PubMed:25657325). Binds specifically to miRNA MIR145 hairpin, regulates MIR145 expression at a postranscriptional level (PubMed:28431233).

Belongs to the class IV-like SAM-binding methyltransferase superfamily.

42.009 kDa

MAERGRKRPCGPGEHGQRIEWRKWKQQKKEEKKKWKDLKLMKKLERQRAQEEQAKRLEEEEAAAEKEDRGRPYTLSVALPGSILDNAQSPELRTYLAGQIARACAIFCVDEIVVFDEEGQDAKTVEGEFTGVGKKGQACVQLARILQYLECPQYLRKAFFPKHQDLQFAGLLNPLDSPHHMRQDEESEFREGIVVDRPTRPGHGSFVNCGMKKEVKIDKNLEPGLRVTVRLNQQQHPDCKTYHGKVVSSQDPRTKAGLYWGYTVRLASCLSAVFAEAPFQDGYDLTIGTSERGSDVASAQLPNFRHALVVFGGLQGLEAGADADPNLEVAEPSVLFDLYVNTCPGQGSRTIRTEEAILISLAALQPGLIQAGARHT