About Products Protein Database Contact

SPL17

Gene
SPL17
Protein
Squamosa promoter-binding-like protein 17
Organism
Oryza sativa subsp. japonica
Length
393 amino acids
Function
Trans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' (By similarity). May be involved in panicle development.
Mass
40.837 kDa
Sequence
MATGGSGGGGGGGGGGDDVHGLKFGKKIYFEQDAAASASAAAVESSSTSSGGGGKKGKGVAAAAAPPPPLPPRCQVEGCGVDLSGVKPYYCRHKVCYMHAKEPIVVVAGLEQRFCQQCSRFHQLPEFDQEKKSCRRRLAGHNERRRKPTPGPLSSRYGRLAASFHEEPGRSRSFVVDFSYPRVPSSVRDAWPAIQPSDRMSGSIQWQGGHELHPHRSAVAGYSDHHAFSSHGGSAAGAPMLHHPAFELTSGGCLAGVATDSSCALSLLSTQPWDTTQSTSSHNRSPPMSSTASAFGGGNNPVSPSVMASNYMAASPGWNSSSRGHDGARNVHLPPPHGVVLNEVPPGSVHHGHFSGELELALQGGAPSNRPEAEHGSGSGAFSHSTNAMNWSL