SPL

Sphingosine-1-phosphate lyase

539 amino acids

Cleaves phosphorylated sphingoid bases (PSBs), such as sphingosine-1-phosphate, into fatty aldehydes and phosphoethanolamine. Elevates stress-induced ceramide production and apoptosis (By similarity).

Belongs to the group II decarboxylase family. Sphingosine-1-phosphate lyase subfamily.

58.272 kDa

MELAMDFALRLRDAANHHLSRYEPLVLLAAPLLALLAARTLHAAAAAVADRGLRTVLLALAMTAIKLLPGVSAYINAEKRKVVDQLQSGGTSTKSTLRTELPTVGLSNQVINDLETLKARDVNWQGKCSGTVYIAGSESEGHFALINKAYSMFSHTNPLHQDVFKSVAQLEAEVVAMTAALLGIKEKSSGGQICGNMTSGGTESILLAVKTSRDYMRTKKGITKPEMIIAESAHSAYDKAAQYFNIKVRRVPVNKEFLADVKGFKRCINGNTIMMVGSAPGFPHGLIDPIEELGELASRYDICLHVDLCLGGFVLPFARKLGYPIPPFDFCVKGVTSISTDVHKYGLAPKGTSIVLYKNHEIRKHQFVAVTEWTGGLYVSPTIAGSRPGGLIAGAWAAMTSLGLNGYMENTGHIMEVSKKIQRGIEDIPGLFVIGKPDMTVVAFGSDSVDIFEVNDIMSSKGWHLNALQRPNSLHICVTLQHTVIYEEFLKDLKDSVDTVKANPGPISGGRAPIYGAAGKMPDRGMVRELLVEFMDASC

SPL

Protein SPOROCYTELESS

314 amino acids

Transcriptional regulator of sporocyte development (PubMed:10465788). Acts as an adapter-like transcriptional repressor recruiting TPL/TPR corepressors to inhibit TCP transcription factors (PubMed:25378179). Required for nucellus and embryo sac development (PubMed:10500234). Plays a central role in patterning both the proximal-distal and the adaxial-abaxial axes during ovule development (PubMed:12183381). Involved in establishing the prospective chalaza of the ovule and in controlling the cell number and the length of the funiculus, and is required for the development of the integuments (PubMed:10976054). Required, with BEL1, for cytokinin-induced PIN1 expression in ovules (PubMed:22786869). Involved in controlling stamen identity (PubMed:19726570). May also regulate the morphology of lateral organs by repressing auxin production (PubMed:18557819).

Belongs to the NOZZLE family.

34.078 kDa

MATSLFFMSTDQNSVGNPNDLLRNTRLVVNSSGEIRTETLKSRGRKPGSKTGQQKQKKPTLRGMGVAKLERQRIEEEKKQLAAATVGDTSSVASISNNATRLPVPVDPGVVLQGFPSSLGSNRIYCGGVGSGQVMIDPVISPWGFVETSSTTHELSSISNPQMFNASSNNRCDTCFKKKRLDGDQNNVVRSNGGGFSKYTMIPPPMNGYDQYLLQSDHHQRSQGFLYDHRIARAASVSASSTTINPYFNEATNHTGPMEEFGSYMEGNPRNGSGGVKEYEFFPGKYGERVSVVAKTSSLVGDCSPNTIDLSLKL