About Products Protein Database Contact

SPH16

Gene
SPH16
Protein
S-protein homolog 16
Organism
Arabidopsis thaliana
Length
137 amino acids
Similarity
Belongs to the plant self-incompatibility (S1) protein family.
Mass
16.337 kDa
Sequence
MKNLLVFIFVFSLCMFDHVSGAGIRIGNELKFQKLLWMRCYSKDDVLGPKIIPIGGHFVTYFSVNIWRTTRFMCTLKQGPNYRHYQNFTAFKLFGMEDHGDVWDWRARENEIYLKKKEGGKFIKNPVNMHKVYDWIN