SPCS2

Signal peptidase complex subunit 2

226 amino acids

Component of the microsomal signal peptidase complex which removes signal peptides from nascent proteins as they are translocated into the lumen of the endoplasmic reticulum.

Belongs to the SPCS2 family.

24.942 kDa

MAAASAQGGRTGGGGGSSGPGGGPTCGSGSGRSGLLDKWKIDDKPVKIDKWDGSAVKNSLDDSAKKVLLEKYKYVENFGLIDGRLTICTISCFFAIVALIWDYMHPFPESKPVLALCVISYFVMMGILTIYTSYKEKSIFLVAHRKDPTGMDPDDIWQLSSSLKRFDDKYTLKLTFISGRTKQQREAEFTKSIAKFFDHSGTLVMDAYEPEISRLHDSLATERKIK

SPCS2

Signal peptidase complex subunit 2

226 amino acids

Component of the microsomal signal peptidase complex which removes signal peptides from nascent proteins as they are translocated into the lumen of the endoplasmic reticulum.

Belongs to the SPCS2 family.

25.003 kDa

MAAAAVQGGRSGGSGGCSGAGGASNCGTGSGRSGLLDKWKIDDKPVKIDKWDGSAVKNSLDDSAKKVLLEKYKYVENFGLIDGRLTICTISCFFAIVALIWDYMHPFPESKPVLALCVISYFVMMGILTIYTSYKEKSIFLVAHRKDPTGMDPDDIWQLSSSLKRFDDKYTLKLTFISGRTKQQREAEFTKSIAKFFDHSGTLVMDAYEPEISRLHDSLAIERKIK

SPCS2

Signal peptidase complex subunit 2

226 amino acids

Component of the microsomal signal peptidase complex which removes signal peptides from nascent proteins as they are translocated into the lumen of the endoplasmic reticulum.

Belongs to the SPCS2 family.

25.014 kDa

MAAAATQGGRSGGLGGNSGAGGGSNCGTGSGRSGLLDKWKIDDKPVKIDKWDGSAVKNSLDDSAKKVLLEKYKYVENFGLIDGRLTICTISCFFAIVALIWDYMHPFPESKPVLALCVISYFVMMGILTIYTSYKEKSIFLVAHRKDPTGMDPDDIWQLSSSLKRFDDKYTLKLTFISGRTKQQREAEFTKSIAKFFDHSGTLVMDAYEPEISRLHDSLAVERKIK

Spcs2

Signal peptidase complex subunit 2

226 amino acids

Component of the microsomal signal peptidase complex which removes signal peptides from nascent proteins as they are translocated into the lumen of the endoplasmic reticulum.

Belongs to the SPCS2 family.

24.978 kDa

MAASASQGGRSGGGGGSSGAGGGPSCGTSSSRSGLLDKWKIDDKPVKIDKWDGSAVKNSLDDSAKKVLLEKYKYVENFGLIDGRLTICTISCFFAIVALIWDYMHPFPESKPVLALCVISYFVMMGILTIYTSYKEKSIFLVAHRKDPTGMDPDDIWQLSSSLKRFDDKYTLKLTFISGRTKQQREAEFTKSIAKFFDHSGTLVMDAYEPEISRLHDSLATERKIK

SPCS2

Signal peptidase complex subunit 2

226 amino acids

Component of the microsomal signal peptidase complex which removes signal peptides from nascent proteins as they are translocated into the lumen of the endoplasmic reticulum.

Belongs to the SPCS2 family.

25.027 kDa

MAAAAAQGGRSGGIGGCIGAGGASNCGTGSGRSGLLDKWKIDDKPVKIDKWDGSAVKNSLDDSAKKVLLEKYKYVENFGLIDGRLTICTISCFFAIVALIWDYMHPFPESKPVLALCVISYFVMMGILTIYTSYKEKSIFLVAHRKDPTGMDPDDIWQLSSSLKRFDDKYTLKLTFISGRTKQQREAEFTKSIAKFFDHSGTLVMDAYEPEISRLHDSLAIERKIK

spcs2

Probable signal peptidase complex subunit 2

201 amino acids

Microsomal signal peptidase is a membrane-bound endoproteinase that removes signal peptides from nascent proteins as they are translocated into the lumen of the endoplasmic reticulum.

Belongs to the SPCS2 family.

23.11 kDa

MAARNGKNSILEKWRIDEKPVKIDKWDGAAVKNSLDDAAKKVLIEKYGYLESFNLVDGRLFICTVSCLFTIVALIWDYLHPFPESKPVLACCVVSYFIMMGILTLYTSYKEKNIFLVAMQKDPAGMDPDHSWCLSSSLKRFDDQYTLRMSFTDGKTKQSRETEFTKSVSVFFDENGTLVMDQYEKYVSKLHDTLATEKKTK

spcs2

Probable signal peptidase complex subunit 2

201 amino acids

Microsomal signal peptidase is a membrane-bound endoproteinase that removes signal peptides from nascent proteins as they are translocated into the lumen of the endoplasmic reticulum.

Belongs to the SPCS2 family.

22.958 kDa

MAARGGKNGLLEKWKIDDKPVKIDKWDGSAVKNSLDDAAKKVLLEKYRYVENFCLIDGRLIICTISCVFAIVALVWDYLHPFPESKPVLAICVISYFLMMGILTIYTSYKEKSIFLVAHRKDPAGMDPDDIWHLSSSLKRFDDKYTLKVTYISGKTKAQRDAEFTKSIARFFDDNGTLVMDLFEPEVSKLHDSLAMEKKTK

spcs2

Signal peptidase complex subunit 2

183 amino acids

Component of the microsomal signal peptidase complex which removes signal peptides from nascent proteins as they are translocated into the lumen of the endoplasmic reticulum.

Belongs to the SPCS2 family.

20.796 kDa

MSTTTTTTTTEKPIQVTLYDSNTIKQTLDDSIVKYVTSALSYTQNQKLNYTKVLFGLIGCTLAAIAQFYPIPFPKNKPVLILCVALYVVISLILYYINIFIQKDYILQASKSNDEIKVATVLQKYDPNYQVKIENAKNSSINVPFSKSIDLYFDTKGTFLESNFHNDLSVQFKKFAKLNVKDK