SPC3

Microsomal signal peptidase subunit 3

190 amino acids

Microsomal signal peptidase is a membrane-bound endoproteinase that removes signal peptides from nascent proteins as they are translocated into the lumen of the endoplasmic reticulum.

Belongs to the SPCS3 family.

21.768 kDa

MFNIVTRFQYAANQALTSSIIIAGIVIVSSLLQLYSNNAWSLGTTSISNIKPQVSLKHSFNYGSVNRKPKENSRIQFDLETDLSPLFNWNTKQLFVYLTAEYPGKSDGSSNKITYWDKIITSKEDAVLSLKNQKSKYSVWDIEPSFRQRDAVVKLEWNLQPHIGPLIFGETDEIADFKFAEYVDKKKEQK

SPC3

Microsomal signal peptidase subunit 3

189 amino acids

Microsomal signal peptidase is a membrane-bound endoproteinase that removes signal peptides from nascent proteins as they are translocated into the lumen of the endoplasmic reticulum.

Belongs to the SPCS3 family.

21.845 kDa

MFSLNQRFQHVSSLALSCSFLVIALIAATSWLQLVKDNVFELESQLSHIRSATRFAKQKRYGGSAVNPTEVSKIRFNADFDFSRLFNWNTKQVFAYVTAEYEGDENPHTMNEITIWDKIIPSRDNATFTLSDIDAKYQLWDLESKITERPLTFKLHWNIQPWFGFLINGETTGSKTIELKKPVDKQKGK

spc3

Probable microsomal signal peptidase subunit 3

185 amino acids

Microsomal signal peptidase is a membrane-bound endoproteinase that removes signal peptides from nascent proteins as they are translocated into the lumen of the endoplasmic reticulum.

Belongs to the SPCS3 family.

21.643 kDa

MIVDTFTNRGSTFFSKLSTVLFFLCAVITFQGVIQRREVELDTPVYVHYAKYRSARFYHAFRNVRQQYAQVKFNMDADLSELWDWNTKHVVVYLVASYSTEKHEKNQVVVWDKILSSPEESKMFMKDTLSNIQAHPFNEYSNQFEGKNATYTLHWTVSPKMGFLSWGAGPGSYEIPFHKIITQPK

SPC3

Microsomal signal peptidase subunit 3

185 amino acids

Microsomal signal peptidase is a membrane-bound endoproteinase that removes signal peptides from nascent proteins as they are translocated into the lumen of the endoplasmic reticulum.

Belongs to the SPCS3 family.

20.925 kDa

MHTSIQRIQQTFSQASTVLSIIAAIVFVVSYIQLVVANVWSLPEANFNLRGSKAARRFSRQYGANDPKKGKENVALKFDLDADLSPLFNWNTKLVFAYLTATYDGKRDDIVNEITIWDQIITDKDDSHIKLKGANSKYSLYDVEESFRNRNATVKLHWNIQPHVGAKIYGSLDATKGSIKFPQLV

SPC3

Signal peptidase complex subunit SPC3

184 amino acids

Component of the signal peptidase complex (SPC), which catalyzes the cleavage of N-terminal signal sequences of proteins targeted to the endoplasmic reticulum. Signal peptide cleavage occurs during the translocation (cotranslationally or post-translationally) through the translocon pore into the endoplasmic reticulum. SPC3 is required for signal peptidase activity and is essential for viability.

Belongs to the SPCS3 family.

21.349 kDa

MFSFVQRFQNVSNQAFSMGIVMVVFIMASSYYQLINNNAFSVPSNIDNVKTLINVRTSRYFGSQRGKAKENMKIKFDLNTDLTPLFNWNTKQVFVYLTAEYNSTEKITSEVTFWDKIIKSKDDAVIDVNDLRSKYSIWDIEDGKFEGKDLVFKLHWNVQPWVGLLTYGETVGNYTLTVENKNKV