SPC24

Probable kinetochore protein SPC24

252 amino acids

Acts as a component of the essential kinetochore-associated NDC80 complex, which is required for chromosome segregation and spindle checkpoint activity.

Belongs to the SPC24 family.

29.16 kDa

MTTSVDKLNKLIEEVNNQDELQLIEEINLYIKTLYELRQVKIDQLSNIIHQLNQQIITSNKEINQLNKINDYNYELINVNNFNFVSQQSFQFTNFDRSSSSSSESTNNIFQMINKRLNELDNLKVVIVKELTDLETNLNNLKYKQNNLHESMEDINDKLDKLLNDMDKSGIMEQDPSILRINLFRNLGIKLENMPPNANSGGGGDSNSNSSNNNNTEEDCVIITDDNNNVNILNIEPKLSDYFISNYIWDKL

SPC24

Probable kinetochore protein SPC24

227 amino acids

Acts as a component of the essential kinetochore-associated NDC80 complex, which is required for chromosome segregation and spindle checkpoint activity.

Belongs to the SPC24 family.

26.412 kDa

MFHEKPDKLLLSSIESFEIEPDLLTLRRIEEVINKTNQYRSNTIENYETKLNTMKSEFQSLMSEINLLTKVSGINYENLKLLGNGNEESMGDLSNKNIFNVMNEKSIELDNLKLSLAKNLNDLESQINSMNITKKDLMEKYELVKMKNDNLINDNILKNPDSKAIKINIYKNLGVEIESGEEGETENKQDKVIIYNKETNLSSILNIDDKYSEYFITNYIWDRLQGY

SPC24

Kinetochore protein SPC24

213 amino acids

Acts as a component of the essential kinetochore-associated NDC80 complex, which is involved in chromosome segregation and spindle checkpoint activity.

Belongs to the SPC24 family.

24.604 kDa

MSQKDNLLDNPVEFLKEVRESFDIQQDVDAMKRIRHDLDVIKEESEARISKEHSKVSESNKKLNAERINVAKLEGDLEYTNEESNEFGSKDELVKLLKDLDGLERNIVSLRSELDEKMKLYLKDSEIISTPNGSKIKAKVIEPELEEQSAVTPEANENILKLKLYRSLGVILDLENDQVLINRKNDGNIDILPLDNNLSDFYKTKYIWERLGK

SPC24

Probable kinetochore protein SPC24

204 amino acids

Acts as a component of the essential kinetochore-associated NDC80 complex, which is required for chromosome segregation and spindle checkpoint activity.

Belongs to the SPC24 family.

22.966 kDa

MPSQAPGPDVLENPADLLRQTRENFSIAHDLQLLNATEENLRRLMQRTQQLEAKGAQELSELQAQQTERAQAAEAMRAEKETQAQHLQALTHSQDLVRLANELEELEQQLVSLRAELDEGMTQLLQTSEPTAAFQGDAEHEQQSPEVQTNLLKLQLYSSLGVTLDTEHNQALIERGDAAGIDLIALEDDSLSPFFRTKYVWDRL

spc24

Kinetochore protein Spc24

202 amino acids

Acts as a component of the essential kinetochore-associated NDC80 complex, which is required for chromosome segregation and spindle checkpoint activity. Required for kinetochore integrity and the organization of stable microtubule binding sites in the outer plate of the kinetochore. The NDC80 complex synergistically enhances the affinity of the SKA1 complex for microtubules and may allow the NDC80 complex to track depolymerizing microtubules.

Belongs to the SPC24 family.

23.398 kDa

MSHSISMHDDDLEKLGESLNEIIMSSKAESVLQAARKKKQEFFDHYIKTKKTLTELLNDLVHTEEVVGQKLLDLDQQKSQMMQEIMKMEQEVQRSQSKSQNLDSELEFLQKELERLRDAEQEIQTLQQEVDEDTTEVIPSAIYVAQLYSKVTKIKLEFDTEPHILKGVHYGADVVTPINIDTSTRTPCEVSDELWSLVKTEW

SPC24

Probable kinetochore protein SPC24

201 amino acids

Acts as a component of the essential kinetochore-associated NDC80 complex, which is required for chromosome segregation and spindle checkpoint activity.

Belongs to the SPC24 family.

22.765 kDa

MLLSEEPATLIHHTIENFNIAPDKTAVARVTESLATLQQARDLRVREAESSLKKLSRQLATHTSRHDDLVTSHSSADHASNIARLDTLKFRTAKAAADAETDAERLALTAADLKARLRELELQGVEGDAAANARRRDPVDDEVLLRLKVYRSLGIDIERDERDGEWSKAVIRNDRKGDVHVVNMDKKFSRFFYANYFWQTL

Spc24

Kinetochore protein Spc24

201 amino acids

Acts as a component of the essential kinetochore-associated NDC80 complex, which is required for chromosome segregation and spindle checkpoint activity. Required for kinetochore integrity and the organization of stable microtubule binding sites in the outer plate of the kinetochore. The NDC80 complex synergistically enhances the affinity of the SKA1 complex for microtubules and may allow the NDC80 complex to track depolymerizing microtubules.

Belongs to the SPC24 family.

23.416 kDa

MAAFRDMVEVSNWLLSLLGANRAEAQQRRLLGSYEQMMERLLEMQDGAYRQLRETLAVEEEVAQSLLELKECTRQGDTELQQLEVELQRTSKEDTCVQARLRQLITELQELREMEEELQRQERDVDEDNTVTIPSAVYVAHLYHQISKIQWDYECEPGMIKGIHHGPTVAQPIHLDSAQLSPKFISDYLWSLVDTTWEPEP

SPC24

Kinetochore protein SPC24 homolog

201 amino acids

Acts as a component of the essential kinetochore-associated NDC80 complex, which is required for chromosome segregation and spindle checkpoint activity to ensure proper cell division. Required for the maintenance of plant architecture.

Belongs to the SPC24 family.

23.332 kDa

MGNASENFDIEDLMSYGDDLINLLNVKNGFDIISQSSEQFKALNFACHEDFNQIQGSIEDCKTKLYACKKKTEEAYSDIAAEDEIERLQKELDEEMEREFKLKDELRLVADELKDLNAQLSSIDEHKQSTKRKVRDDLRAEKKLSMYASVTNVIPDIDDPSKISGYMVDREKRLIEKFQFETNKMTAYETCNSIWSIINKQ

SPC24

Probable kinetochore protein SPC24

201 amino acids

Acts as a component of the essential kinetochore-associated NDC80 complex, which is required for chromosome segregation and spindle checkpoint activity.

Belongs to the SPC24 family.

23.155 kDa

MASTEEIVQMMQEASAEFAEADDVSFLDKMNSNIAQLEQQLREQMDESRQNIAKLEINLIDTEKSIGSLRELMKDATDEATIMKGSDKLNNLIDELQATENEIQMMNSEIEKKVSKLVEDEDNTSSEYEMISKELEQEYDPVFASNILKLKLYRSLGVRLDLDNNQILIQNKELGTIDTLPLEDELTEFFKVKYIWSRIGK

spc24

Probable kinetochore protein spc24

200 amino acids

Acts as a component of the essential kinetochore-associated NDC80 complex, which is required for chromosome segregation and spindle checkpoint activity.

Belongs to the SPC24 family.

22.688 kDa

MLLDENPSTLIHHTIGNFNIAPDKQAVSRINDSLATLQQSRELRMREAESSLRKLSRHLQSLSTQHEEAVAAHDASKHAAAMVELDTKKFRIAKAASELEIESERLEGELEMLKERLADLEAQGLEGDEATRREREADDAILLRLKIYRALGIDIEPDEAGNFTKAVIRNSRKGDVHVVNLDPKFSRFFYANYFWSTMQG

spc24

Probable kinetochore protein spc24

200 amino acids

Acts as a component of the essential kinetochore-associated NDC80 complex, which is required for chromosome segregation and spindle checkpoint activity.

Belongs to the SPC24 family.

22.783 kDa

MLLDEDPATLIHHTIGNFNIQPDKQAVTRINDSLSTLQQSRELRMRDAESALRKLSRNLHALTAQHEEAVSSHDSAKHAAQMVELDTKKFRIAKAATELEIESERLEGELEMLKERLAELEAQGLEGDEATRREREADDATILRLKIYRSLGIDIEADEAGNFSKAVIRNSRKGDVHVVNMDPKFSRFFYANYFWSTMQG

spc24

Probable kinetochore protein spc24

200 amino acids

Acts as a component of the essential kinetochore-associated NDC80 complex, which is required for chromosome segregation and spindle checkpoint activity.

Belongs to the SPC24 family.

22.876 kDa

MLLDENPGTLIHHTIGNFNIQPDKQAVTRINDSLSTLQQSRELRMREAESSLRKLSRHLHSLNAQHEEAVAAHDSSKHAADMVELDTKKFRIAKAATELEIESERLESELEMLKERLADLEAQGLEGDEATRRERELDDATILRLKIYRSLGVDIEADDAGNFNKAVIRNSRKGDVHVVNIDPKFSRFFYSNYFWSTMQG

spc24

Kinetochore protein Spc24

199 amino acids

Acts as a component of the essential kinetochore-associated NDC80 complex, which is required for chromosome segregation and spindle checkpoint activity (PubMed:14738735). Required for kinetochore integrity and the organization of stable microtubule binding sites in the outer plate of the kinetochore (PubMed:14738735). The NDC80 complex synergistically enhances the affinity of the SKA1 complex for microtubules and may allow the NDC80 complex to track depolymerizing microtubules (By similarity).

Belongs to the SPC24 family.

22.722 kDa

MLCEQISEYVDVSREIVKVMVSDSAAGALKKSLDRQEAMIDSLLDTEVQASQLIRDLMAVEEKVAQKLLDTEETKQKSSSKLQKIDRELQERMEKNASLESSIKFLQKDLEELKVMEEEIADMQREADEDTTTVIPSAVYLAKLFHNVTKIDWDYNCDPSLIKGIHYGGDIAQPISIDSNQHSKIFICNYLWSLLSTDW

spc24

Kinetochore protein spc24

199 amino acids

Acts as a component of the essential kinetochore-associated NDC80 complex, which is required for chromosome segregation and spindle checkpoint activity. Required for kinetochore integrity and the organization of stable microtubule binding sites in the outer plate of the kinetochore. The NDC80 complex synergistically enhances the affinity of the SKA1 complex for microtubules and may allow the NDC80 complex to track depolymerizing microtubules.

Belongs to the SPC24 family.

22.87 kDa

MLCEQIKEYVDVSREIVKVMVSDSAAVALKKSLDRQEAMIDLLLDTETEASQLIRDFMAVEEKVAQTLLDTEETKQKTSSKLQKIERELQEKIEKNSSLESGIKFLQKELEELKMMEEEIADMEREADEDTTTVIPSAVYLAKLFHNVTKIDWDYNCDPSLIKGIHYGGEIAQPISIDSNQHSKIFICNYLWSLLSTDW

spc24

Kinetochore protein spc24

198 amino acids

Acts as a component of the NMS (Ndc80-MIND-Spc7) super complex which has a role in kinetochore function during late meiotic prophase and throughout the mitotic cell cycle. Acts as a component of the essential kinetochore-associated NDC80 complex, which is required for chromosome segregation and spindle checkpoint activity.

Belongs to the SPC24 family.

23.039 kDa

MSDSPIELMRSTLAGFQIAPDVKTISNIQDIRAQIQSFREKELEGSQTKFKVLSRKLEISTQAMESLKQTAESSQHAEEILSREKEKFRIAKLLNITENEIMSLESQLQKMKEQLLQLEERENTSEDICQSEENANMLKLNFYHSLGFDLETAENTGNKRVIIHTENDLQTVQISNKYSPYFYSNYFWDLLDDSKDKK

SPC24

Kinetochore protein Spc24

197 amino acids

Acts as a component of the essential kinetochore-associated NDC80 complex, which is required for chromosome segregation and spindle checkpoint activity (PubMed:14738735). Required for kinetochore integrity and the organization of stable microtubule binding sites in the outer plate of the kinetochore (PubMed:14738735). The NDC80 complex synergistically enhances the affinity of the SKA1 complex for microtubules and may allow the NDC80 complex to track depolymerizing microtubules (PubMed:23085020).

Belongs to the SPC24 family.

22.478 kDa

MAAFRDIEEVSQGLLSLLGANRAEAQQRRLLGRHEQVVERLLETQDGAEKQLREILTMEKEVAQSLLNAKEQVHQGGVELQQLEAGLQEAGEEDTRLKASLLYLTRELEELKEIEADLERQEKEVDEDTTVTIPSAVYVAQLYHQVSKIEWDYECEPGMVKGIHHGPSVAQPIHLDSTQLSRKFISDYLWSLVDTEW

SPC24

Kinetochore protein Spc24

197 amino acids

Acts as a component of the essential kinetochore-associated NDC80 complex, which is required for chromosome segregation and spindle checkpoint activity. Required for kinetochore integrity and the organization of stable microtubule binding sites in the outer plate of the kinetochore. The NDC80 complex synergistically enhances the affinity of the SKA1 complex for microtubules and may allow the NDC80 complex to track depolymerizing microtubules.

Belongs to the SPC24 family.

22.756 kDa

MAAFRDMEEVSQGLLSLLGANRAEAQQRRLLGRHEQKVERLLETQDGAEKWLREILTTEKEVAQRLLDAKEQAHQGGVEVRQLEAELQRASEEDAHLKANLLQLTRELEELKEIEADLERQEKEVDEDTTVTIPSAVYVAQLYRRISKIEWDYECEPGMIKGIHHGPSVAQPIHLDSTQLSKKFISDYLWNLVDTEW

SPC24

Probable kinetochore protein SPC24

189 amino acids

Acts as a component of the essential kinetochore-associated NDC80 complex, which is required for chromosome segregation and spindle checkpoint activity.

Belongs to the SPC24 family.

22.048 kDa

MSRLNDPVELLQQTRSNFIIESDVSNIKEIKSNMRQLTKLMAEKQTHHNELMKQLQSQLQRQQTKVQALKKNFQEQTSQVKRVEDELNIPKLQQDIDKLVQEINQLRDTIQEGIQKVVETQKQLLNDDTDAAHTIDEEPIGKDDKIRVLKLKLFHSLDVALYNDQLLDLRNEARPLSSSSSSHNIWDEL

SPC24

Probable kinetochore protein SPC24

189 amino acids

Acts as a component of the essential kinetochore-associated NDC80 complex, which is required for chromosome segregation and spindle checkpoint activity.

Belongs to the SPC24 family.

21.475 kDa

MDPIDLLRDVAKSFSTNEEIASTERVSVDITRLSLFREAKLAEARDKLQDQIRQRDLCQESVAGDSTTSERTQHVHELEREKMRLARAINDLEETLNATQAATSKLNAELELVEKESQQPIESAVENDSSAALQLKLFRTLGVTFDAEKPEKYTKCMIRSNTTSNVATLDLNVKEYSGFFITNYIWDKL