SPC19

DASH complex subunit SPC19

177 amino acids

Component of the DASH complex, a microtubule-binding subcomplex of the outer kinetochore that is essential for proper chromosome segregation. The DASH complex mediates the formation and maintenance of bipolar kinetochore-microtubule attachments by forming closed rings around spindle microtubules and establishing interactions with proteins from the central kinetochore (By similarity).

Belongs to the DASH complex SPC19 family.

19.783 kDa

MSHTYNSLSNCISSLSASVALLNDSLKTIDNATKDIPRLKKVLSTNKVFGLVPESDLESAKRNIQNEIQPQINALVIKIEKELSKLKRKKTNLASKVDLQQVRLENAAKSNRDSLSGIKGITANRISKGDIDESKLARLKLLQNKKERLKYSLSRLNLQDKRARLSTIPSLPPHRDS

SPC19

DASH complex subunit SPC19

175 amino acids

Component of the DASH complex, a microtubule-binding subcomplex of the outer kinetochore that is essential for proper chromosome segregation. The DASH complex mediates the formation and maintenance of bipolar kinetochore-microtubule attachments by forming closed rings around spindle microtubules and establishing interactions with proteins from the central kinetochore (By similarity).

Belongs to the DASH complex SPC19 family.

20.454 kDa

MTQQDLPQNQRFNNLDNCTDSLRQSIKILQQSNKILDETLQDSTRLTKILSTNKVFDLIPELDLNDAKSNFTKNITPQLNQQLNKLEDELIQLQTKKTTLTNKLKLINVRLKNYEKKGNKEEGGKNFNSNGLSDIDIDNLLTNRHKNGYDVNKLHQLRFLRDKKTRLQYSLNRLN

SPC19

DASH complex subunit SPC19

166 amino acids

Component of the DASH complex, a microtubule-binding subcomplex of the outer kinetochore that is essential for proper chromosome segregation. The DASH complex mediates the formation and maintenance of bipolar kinetochore-microtubule attachments by forming closed rings around spindle microtubules and establishing interactions with proteins from the central kinetochore (By similarity).

Belongs to the DASH complex SPC19 family.

19.219 kDa

MTNTLDDSIGSMQNCVSIVRDTSLKLRSRAQTPEETERIKKVLQLTRKYEEVTQSEVLAAQQRQAAEIAPQVQDLIGGVEKQISSLHSKERKLKSQSELNKSRLEQFPMTRREVVDVPRDADNVVEVTEEELQELEELQREREKLKMEISRLNLEKRKSVYGKLPQ

SPC19

DASH complex subunit SPC19

165 amino acids

Component of the DASH complex, a microtubule-binding subcomplex of the outer kinetochore that is essential for proper chromosome segregation. The DASH complex mediates the formation and maintenance of bipolar kinetochore-microtubule attachments by forming closed rings around spindle microtubules and establishing interactions with proteins from the central kinetochore. The DASH ring complex may both stabilize microtubules during chromosome attachment in anaphase A, and allow the chromosome to remain attached to the depolymerizing microtubule in anaphase B. Microtubule depolymerization proceeds by protofilament splaying and induces the kinetochore-attached ring to slide longitudinally, thereby helping to transduce depolymerization energy into pulling forces to disjoin chromatids.

Belongs to the DASH complex SPC19 family.

18.91 kDa

MTDALEQSVLALEGTVSVLKDSVESLKCANEPSTNLASTMLQTKRVFRLVPEYDVERSKLDLIEEVEPLVRTLGDKLRKSMGRMQRELDTLQQTYELNDLRLKKNISMDDDDALNSPDMGQEYEGRDADDVVMMASSTNEELEELKKLKEKKKQLENKLEILKQK

SPC19

DASH complex subunit SPC19

154 amino acids

Component of the DASH complex, a microtubule-binding subcomplex of the outer kinetochore that is essential for proper chromosome segregation. The DASH complex mediates the formation and maintenance of bipolar kinetochore-microtubule attachments by forming closed rings around spindle microtubules and establishing interactions with proteins from the central kinetochore (By similarity).

Belongs to the DASH complex SPC19 family.

17.278 kDa

MQSLEQCVNSLEAIVHQLDGSVSRLARNGEASNELCEGILKIKRVFELVPEYDVESARLALFEEVDPMVKTLGDKIEKALIRKRRELENLRQTSELNSLRLSGDLYFSETGIDNQDMDVSTDAIAIASATDAELDELRALKARRAELQELLDGR

SPC19

DASH complex subunit SPC19

153 amino acids

Component of the DASH complex, a microtubule-binding subcomplex of the outer kinetochore that is essential for proper chromosome segregation. The DASH complex mediates the formation and maintenance of bipolar kinetochore-microtubule attachments by forming closed rings around spindle microtubules and establishing interactions with proteins from the central kinetochore (By similarity).

Belongs to the DASH complex SPC19 family.

17.772 kDa

MEEVLSEGVDALAACVDDMAKCLTVSKVTTDRSTKLAINMLQTKRVFQLVSEYDVQRARLDLMEDIEPLLQKLYSKLEKALTKLERERATLSQTFELNKLRFNNQESNPIIDNVKSDPVVIVSSTHEELERLKDLKNRKEELIQRIQELHEER

spc19

DASH complex subunit spc19

152 amino acids

Component of the DASH complex, a microtubule-binding subcomplex of the outer kinetochore that is essential for proper chromosome segregation. The DASH complex mediates the formation and maintenance of bipolar kinetochore-microtubule attachments by forming closed rings around spindle microtubules and establishing interactions with proteins from the central kinetochore. May be necessary for growth under high osmotic stress.

Belongs to the DASH complex SPC19 family.

17.494 kDa

MSYLDGLQQCVDSLQISIGTLSSSIDTLESGIHDFPRIKHILKVQRHFNLISEDELSARQAKFEEIVKPILSKAFQRLEDSISSLQRQEDSLKTKYELQEARLDMLKNRPATSAFSVTTESSEQLKAIIAKRQKLVYTLERYTLQLQQKRGH

SPC19

DASH complex subunit SPC19

148 amino acids

Component of the DASH complex, a microtubule-binding subcomplex of the outer kinetochore that is essential for proper chromosome segregation. The DASH complex mediates the formation and maintenance of bipolar kinetochore-microtubule attachments by forming closed rings around spindle microtubules and establishing interactions with proteins from the central kinetochore (By similarity).

Belongs to the DASH complex SPC19 family.

16.85 kDa

MDISLDESCVALESSVKLLGKTLERLAEQGEHSRRLTSTLLRSKRVFELVSEYDLQRARLDVIEEVEPVVEKLCSKLEKSLNKLERERATLQQTYELNQLRLNNRLAGSGGRRPVVMGTSTTEELGRLREAKQRKAALEREIAEVRGT