SPARC

SPARC

303 amino acids

Appears to regulate cell growth through interactions with the extracellular matrix and cytokines. Binds calcium and copper, several types of collagen, albumin, thrombospondin, PDGF and cell membranes. There are two calcium binding sites; an acidic domain that binds 5 to 8 Ca(2+) with a low affinity and an EF-hand loop that binds a Ca(2+) ion with a high affinity.

Belongs to the SPARC family.

34.632 kDa

MRAWIFFLLCLAGRALAAPQQEALPDETEVVEETVAEVTEVSVGANPVQVEVGEFDDGAEETEEEVVAENPCQNHHCKHGKVCELDENNTPMCVCQDPTSCPAPIGEFEKVCSNDNKTFDSSCHFFATKCTLEGTKKGHKLHLDYIGPCKYIPPCLDSELTEFPLRMRDWLKNVLVTLYERDEDNNLLTEKQKLRVKKIHENEKRLEAGDHPVELLARDFEKNYNMYIFPVHWQFGQLDQHPIDGYLSHTELAPLRAPLIPMEHCTTRFFETCDLDNDKYIALDEWAGCFGIKQKDIDKDLVI

SPARC

SPARC

303 amino acids

Appears to regulate cell growth through interactions with the extracellular matrix and cytokines. Binds calcium and copper, several types of collagen, albumin, thrombospondin, PDGF and cell membranes. There are two calcium binding sites; an acidic domain that binds 5 to 8 Ca(2+) with a low affinity and an EF-hand loop that binds a Ca(2+) ion with a high affinity (By similarity).

Belongs to the SPARC family.

34.632 kDa

MRAWIFFLLCLAGRALAAPQQEALPDETEVVEETVAEVTEVSVGANPVQVEVGEFDDGAEETEEEVVAENPCQNHHCKHGKVCELDENNTPMCVCQDPTSCPAPIGEFEKVCSNDNKTFDSSCHFFATKCTLEGTKKGHKLHLDYIGPCKYIPPCLDSELTEFPLRMRDWLKNVLVTLYERDEDNNLLTEKQKLRVKKIHENEKRLEAGDHPVELLARDFEKNYNMYIFPVHWQFGQLDQHPIDGYLSHTELAPLRAPLIPMEHCTTRFFETCDLDNDKYIALDEWAGCFGIKQKDIDKDLVI

SPARC

SPARC

303 amino acids

Appears to regulate cell growth through interactions with the extracellular matrix and cytokines. Binds calcium and copper, several types of collagen, albumin, thrombospondin, PDGF and cell membranes. There are two calcium binding sites; an acidic domain that binds 5 to 8 Ca(2+) with a low affinity and an EF-hand loop that binds a Ca(2+) ion with a high affinity.

Belongs to the SPARC family.

34.613 kDa

MRAWIFFLLCLAGRALAAPQQEALPDETEVVEETVAEVAEVPVGANPVQVEVGEFDDGAEETEEEVVAENPCQNHHCKHGKVCELDENNTPMCVCQDPTSCPAPIGEFEKVCSNDNKTFDSSCHFFATKCTLEGTKKGHKLHLDYIGPCKYIPPCLDSELTEFPLRMRDWLKNVLVTLYERDEDNNLLTEKQKLRVKKIHENEKRLEAGDHPVELLARDFEKNYNMYIFPVHWQFGQLDQHPIDGYLSHTELAPLRAPLIPMEHCTTRFFETCDLDNDKYIALDEWAGCFGIKEKDIDKDLVI

Sparc

SPARC

302 amino acids

Appears to regulate cell growth through interactions with the extracellular matrix and cytokines. Binds calcium and copper, several types of collagen, albumin, thrombospondin, PDGF and cell membranes. There are two calcium binding sites; an acidic domain that binds 5 to 8 Ca(2+) with a low affinity and an EF-hand loop that binds a Ca(2+) ion with a high affinity.

Belongs to the SPARC family.

34.45 kDa

MRAWIFFLLCLAGRALAAPQQTEVAEEIVEEETVVEETGVPVGANPVQVEMGEFEDGAEETVEEVVADNPCQNHHCKHGKVCELDESNTPMCVCQDPTSCPAPIGEFEKVCSNDNKTFDSSCHFFATKCTLEGTKKGHKLHLDYIGPCKYIAPCLDSELTEFPLRMRDWLKNVLVTLYERDEGNNLLTEKQKLRVKKIHENEKRLEAGDHPVELLARDFEKNYNMYIFPVHWQFGQLDQHPIDGYLSHTELAPLRAPLIPMEHCTTRFFETCDLDNDKYIALEEWAGCFGIKEQDINKDLVI

Sparc

SPARC

301 amino acids

Appears to regulate cell growth through interactions with the extracellular matrix and cytokines. Binds calcium and copper, several types of collagen, albumin, thrombospondin, PDGF and cell membranes. There are two calcium binding sites; an acidic domain that binds 5 to 8 Ca(2+) with a low affinity and an EF-hand loop that binds a Ca(2+) ion with a high affinity.

Belongs to the SPARC family.

34.296 kDa

MRAWIFFLLCLAGRALAAPQTEAAEEMVAEETVVEETGLPVGANPVQVEMGEFEEGAEETVEEVVAENPCQNHHCKHGKVCELDESNTPMCVCQDPTSCPAPIGEFEKVCSNDNKTFDSSCHFFATKCTLEGTKKGHKLHLDYIGPCKYIAPCLDSELTEFPLRMRDWLKNVLVTLYERDEGNNLLTEKQKLRVKKIHENEKRLEAGDHPVELLARDFEKNYNMYIFPVHWQFGQLDQHPIDGYLSHTELAPLRAPLIPMEHCTTRFFETCDLDNDKYIALEEWAGCFGIKEQDINKDLVI

SPARC

SPARC

300 amino acids

Appears to regulate cell growth through interactions with the extracellular matrix and cytokines. Binds calcium and copper, several types of collagen, albumin, thrombospondin, PDGF and cell membranes. There are two calcium binding sites; an acidic domain that binds 5 to 8 Ca(2+) with a low affinity and an EF-hand loop that binds a Ca(2+) ion with a high affinity (By similarity).

Belongs to the SPARC family.

34.24 kDa

MRAWIFFLLCLAGKALAAPQQEALPDETEVVEETVAEVPVGANPVQVEVGEFDDGAEEAEEEVVAENPCQNHHCKHGKVCELDENNSPMCVCQDPTSCPAPIGEFEKVCSNDNKTFDSSCHFFATKCTLEGTKKGHKLHLDYIGPCKYIPPCLDSELTEFPLRMRDWLKNVLVTLYERDENNNLLTEKQKLRVKKIHENEKRLEAGDHPVELLARDFEKNYNMYIFPVHWQFGQLDQHPIDGYLSHTELAPLRAPLIPMEHCTTRFFQTCDLDNDKYIALDEWAGCFGIKEQDIDKDLVI

sparc

SPARC

300 amino acids

Appears to regulate cell growth through interactions with the extracellular matrix and cytokines. Binds calcium and copper, several types of collagen, albumin, thrombospondin, PDGF and cell membranes. There are two calcium binding sites; an acidic domain that binds 5 to 8 Ca(2+) with a low affinity and an EF-hand loop that binds a Ca(2+) ion with a high affinity (By similarity).

Belongs to the SPARC family.

34.596 kDa

MRVWVFFVLCLAGKALAAPQQDALPEEEEVIEDVPAEETVGTNPVQVDVGEFDEAINEEEEEEPSENPCLNHHCKHGKVCEVDESNTPLCVCQDPSTCPTSVGEFEKICGTDNKTYDSSCHFFATKCTLEGTKKGHKLHLDYIGPCKYIAPCLDNELSEFPLRIGDWLKNVLVSLYERDENNNLLNEKQKLRVKKIHENEKRLESWRPHSELLVRDFEKNYNMYIFPVHWQFGQLDQHPIDGYLSHTELSPLRAPLIPMEHCTTRFFDECDIDDDKYIALEEWAKCFGIKEQDVDKDMIV

SPARC

SPARC

298 amino acids

Appears to regulate cell growth through interactions with the extracellular matrix and cytokines. Binds calcium and copper, several types of collagen, albumin, thrombospondin, PDGF and cell membranes. There are two calcium binding sites; an acidic domain that binds 5 to 8 Ca(2+) with a low affinity and an EF-hand loop that binds a Ca(2+) ion with a high affinity (By similarity).

Belongs to the SPARC family.

34.061 kDa

MRTWIFFFLCLAGKALAAPQEALADETEVIEDLTTEGPVGANPVQVEVGEFEEPTEDVEEIVAENPCQNHHCKHGKVCEVDDNNSPMCVCQDPSSCPAHSGVFEKVCGTDNKTYDSSCHFFATKCTLEGTKKGHKLHLDYIGPCKFIPACLDTELTEFPLRMRDWLKNVLITLYERDEDNNLLTEKQKLKVKNIHENEKRLEAGDHTVELLARDFEKNYNMYIFPVHWQFGQLDQHPIDGYLSHTELAPLRAPLIPMEHCTTRFFEACDLDFDKYIALEEWASCFGIKEQDIDKDLVI

SPARC

SPARC

298 amino acids

Appears to regulate cell growth through interactions with the extracellular matrix and cytokines. Binds calcium and copper, several types of collagen, albumin, thrombospondin, PDGF and cell membranes. There are two calcium binding sites; an acidic domain that binds 5 to 8 Ca(2+) with a low affinity and an EF-hand loop that binds a Ca(2+) ion with a high affinity (By similarity).

Belongs to the SPARC family.

34.052 kDa

MRAWIFFLLCLAGKALAAPQEALPDETEVIEDVTTEEPVGANPVQVEVGEFEEPTEDVEEIVAENPCQNHHCKHGKVCEVDDNNSPMCVCQDPSSCPATSGVFEKVCGTDNKTYDSSCHFFATKCTLEGTKKGHKLHLDYIGPCKFIPPCLDTELTEFPLRMRDWLKNVLITLYERDEDNNLLTEKQKLKVKKIHENEKRLEAGDHTVELLARDFEKNYNMYIFPVHWQFGQLDQHPIDGYLSHTELAPLRAPLIPMEHCTTRFFEACDLDNDKYIALEEWASCFGIKEKDIDKDLVI

SPARC

SPARC

273 amino acids

Appears to regulate cell growth through interactions with the extracellular matrix and cytokines. Binds calcium and copper, several types of collagen, albumin, thrombospondin, PDGF and cell membranes. There are two calcium binding sites; an acidic domain that binds 5 to 8 Ca(2+) with a low affinity and an EF-hand loop that binds a Ca(2+) ion with a high affinity (By similarity).

Belongs to the SPARC family.

31.141 kDa

single

MKAWIFFLVCLAGRALAAPQQEALPDETEVVEETVAEVAEVAEVPVGANPVQVEVGEFEEVEETEEEVVAENPCQNHHCKHGKVCELDENNTPMCVCQDPTSCPAPVGEFEKVCSNDNKTFDSSCHFFATKCTLEGTKKGHKLHLDYIGPCKYIPPCLDSELSEFPLRMRDWLKNVLVTLYERDEGNNLLTEKQKLRVKKIHENEKRLEAGDHPVELLARDFEKNYNMYIFPVHWQFGQLDQHPIDGYLSHTELAPLRAPLIPMEHCTTRFFE

SPARC

SPARC

26 amino acids

Appears to regulate cell growth through interactions with the extracellular matrix and cytokines. Binds calcium and copper, several types of collagen, albumin, thrombospondin, PDGF and cell membranes. There are two calcium binding sites; an acidic domain that binds 5 to 8 Ca(2+) with a low affinity and an EF-hand loop that binds a Ca(2+) ion with a high affinity (By similarity).

Belongs to the SPARC family.

2.94 kDa

single

DKYIALGEWAGCFGIKEKDIDKDLVI