SOX2

Transcription factor SOX-2

320 amino acids

Transcription factor that forms a trimeric complex with OCT4 on DNA and controls the expression of a number of genes involved in embryonic development such as YES1, FGF4, UTF1 and ZFP206. Critical for early embryogenesis and for embryonic stem cell pluripotency (By similarity). May function as a switch in neuronal development. Downstream SRRT target that mediates the promotion of neural stem cell self-renewal (By similarity). Keeps neural cells undifferentiated by counteracting the activity of proneural proteins and suppresses neuronal differentiation (By similarity).

34.481 kDa

MYNMMETELKPPGPQQTSGGGGGGGGNSTAAAAGGNQKNSPDRVKRPMNAFMVWSRGQRRKMAQENPKMHNSEISKRLGAEWKLLSETEKRPFIDEAKRLRALHMKEHPDYKYRPRRKTKTLMKKDKYTLPGGLLAPGGNSMASGVGVGAGLGAGVNQRMDSYAHMNGWSNGSYSMMQDQLGYPQHPGLNAHGAAQMQPMHRYDVSALQYNSMTSSQTYMNGSPTYSMSYSQQGTPGMALGSMGSVVKSEASSSPPVVTSSSHSRAPCQAGDLRDMISMYLPGAEVPEPAAPSRLHMSQHYQSGPVPGTAINGTLPLSHM

Sox2

Transcription factor SOX-2

319 amino acids

Transcription factor that forms a trimeric complex with OCT4 on DNA and controls the expression of a number of genes involved in embryonic development such as YES1, FGF4, UTF1 and ZFP206. Critical for early embryogenesis and for embryonic stem cell pluripotency. May function as a switch in neuronal development. Downstream SRRT target that mediates the promotion of neural stem cell self-renewal. Keeps neural cells undifferentiated by counteracting the activity of proneural proteins and suppresses neuronal differentiation (By similarity).

34.454 kDa

MYNMMETELKPPGPQQASGGGGGGGNATAAATGGNQKNSPDRVKRPMNAFMVWSRGQRRKMAQENPKMHNSEISKRLGAEWKLLSETEKRPFIDEAKRLRALHMKEHPDYKYRPRRKTKTLMKKDKYTLPGGLLAPGGNSMASGVGVGAGLGGGLNQRMDSYAHMNGWSNGSYSMMQEQLGYPQHPGLNAHGAAQMQPMHRYVVSALQYNSMTSSQTYMNGSPTYSMSYSQQGTPGMALGSMGSVVKSEASSSPPVVTSSSHSRAPCQAGDLRDMISMYLPGAEVPEPAAPSRLHMAQHYQSGPVPGTAKYGTLPLSHM

SOX2

Transcription factor SOX-2

317 amino acids

Transcription factor that forms a trimeric complex with OCT4 on DNA and controls the expression of a number of genes involved in embryonic development such as YES1, FGF4, UTF1 and ZFP206 (By similarity). Critical for early embryogenesis and for embryonic stem cell pluripotency. May function as a switch in neuronal development. Downstream SRRT target that mediates the promotion of neural stem cell self-renewal (By similarity). Keeps neural cells undifferentiated by counteracting the activity of proneural proteins and suppresses neuronal differentiation (By similarity).

34.31 kDa

MYNMMETELKPPGPQQTSGGGGGNSTAAAAGGNQKNSPDRVKRPMNAFMVWSRGQRRKMAQENPKMHNSEISKRLGAEWKLLSETEKRPFIDEAKRLRALHMKEHPDYKYRPRRKTKTLMKKDKYTLPGGLLAPGGNSMASGVGVGAGLGAGVNQRMDSYAHMNGWSNGSYSMMQDQLGYPQHPGLNAHGAAQMQPMHRYDVSALQYNSMTSSQTYMNGSPTYSMSYSQQGTPGMALGSMGSVVKSEASSSPPVVTSSSHSRAPCQAGDLRDMISMYLPGAEVPEPAAPSRLHMSQHYQSGPVPGTAINGTLPLSHM

SOX2

Transcription factor SOX-2

315 amino acids

Transcriptional activator. May function as a switch in neuronal development. Downstream SRRT target that mediates the promotion of neural stem cell self-renewal (By similarity). Keeps neural cells undifferentiated by counteracting the activity of proneural proteins and suppresses neuronal differentiation. In cooperation with other transcription factors, binds to the promoter sequence of the crystallin gene to activate transcription in the lens. Binds to the consensus DNA sequence 5'-TCATTGTTGTTG-3'.

34.511 kDa

MYNMMETELKPPAPQQTSGGGTGNSNSAANNQKNSPDRVKRPMNAFMVWSRGQRRKMAQENPKMHNSEISKRLGAEWKLLSEAEKRPFIDEAKRLRALHMKEHPDYKYRPRRKTKTLMKKDKYTLPGGLLAPGTNTMTTGVGVGATLGAGVNQRMDSYAHMNGWTNGGYGMMQEQLGYPQHPGLNAHNAAQMQPMHRYDVSALQYNSMTSSQTYMNGSPTYSMSYSQQGTPGMALGSMGSVVKTESSSSPPVVTSSSHSRAPCQAGDLRDMISMYLPGAEVPEPAAPSRLHMSQHYQSAPVPGTAINGTLPLSHM

sox2

Transcription factor Sox-2

315 amino acids

Transcriptional activator. May function as a switch in neuronal development (By similarity). Downstream SRRT target that mediates the promotion of neural stem cell self-renewal (By similarity).

34.698 kDa

MYNMMETELKPPAPQPNTGGTGNTNSSGNNQKNSPDRIKRPMNAFMVWSRGQRRKMAQENPKMHNSEISKRLGAEWKLLSESEKRPFIDEAKRLRALHMKEHPDYKYRPRRKTKTLMKKDKYTLPGGLLAPGGNGMGAGVGVGAGLGAGVNQRMDSYAHMNGWTNGGYGMMQEQLGYPQHPSLNAHNTAQMQPMHRYDMSALQYNSMTNSQTYMNGSPTYSMSYSQQSTPGMTLGSMGSVVKSESSSSPPVVTSSSHSRAGQCQTGDLRDMISMYLPGAEVQDQSAQSRLHMSQHYQSAPVPGTTINGTIPLSHM

sox2

Transcription factor Sox-2

311 amino acids

Transcriptional activator (By similarity). Functions as a switch in neuronal development, participating in the differentiation of embryonic neuroectodermal cells into neural tissues by making the ectodermal cells responsive to FGF-neuralizing signals. Downstream SRRT target that mediates the promotion of neural stem cell self-renewal (By similarity).

34.106 kDa

MYSMMETELKPPAPQQPSGGNSNSASNNQNKNSPDRVKRPMNAFMVWSRGQRRKMAQENPKMHNSEISKRLGAEWKLLSEAEKRPFIDEAKRLRALHMKEHPDYKYRPRRKTKTLMKKDKYTLPGGLLAPGANAMTSGVGGSLGAGVNQRMDTYAHMNGWTNGGYGMMQEQLGYPQHPGLNAHNAPQMQPMHRYDVSALQYNSMSSSQTYMNGSPTYSMSYSQQGAPGMSLGSMGSVVKSESSSSPPVVTSSSHSRAPCQAGDLRDMISMYLPGAEVPESAAQSRLHMSQHYQSASVAGTGINGTLPLSHM

sox2

Transcription factor Sox-2

311 amino acids

Transcriptional activator. Functions as a switch in neuronal development, participating in the differentiation of embryonic neuroectodermal cells into neural tissues by making the ectodermal cells responsive to FGF-neuralizing signals (By similarity). Downstream SRRT target that mediates the promotion of neural stem cell self-renewal (By similarity).

34.089 kDa

MYNMMETDLKPPAPQQASGGNSNSGSNNQSKNSPDRVKRPMNAFMVWSRGQRRKMAQENPKMHNSEISKRLGAEWKLLSEAEKRPFIDEAKRLRALHMKEHPDYKYRPRRKTKTLMKKDKYTLPGGLLAPGANPMTSGVGASLGAGVNQRMDTYAHMNGWTNGGYGMMQEQLGYPQHPGLSAHNAPQMQPMHRYDVSALQYNSMSSSQTYMNGSPTYSMSYSQQGAPGMSLGSMGSVVKSESSSSPPVVTSSSHSRAPCQAGDLRDMISMYLPGAEVPEPAAQSRLHMSQHYQSASVAGTAINGTLPLSHM