SOSTDC1

Sclerostin domain-containing protein 1

206 amino acids

Can activate or inhibit Wnt signaling in a context-dependent manner. Activates the canonical Wnt pathway whereby acts through Disheveled proteins and beta-catenin. Antagonises Wnt signaling through the canonical pathways presumably by blocking accessibility of certain WNTs to their receptors. Induces posterior neural markers via components of the canonical Wnt pathway.

Belongs to the sclerostin family.

23.144 kDa

MLLSAIHFYGLLLACTFTRSYSAFKNDATEILYSHVVKPAPASPSSNSTLNQARNGGRHYAGTGSDRNNRVQVGCRELRSTKYISDGQCTSINPLKELVCAGECLPLPLLPNWIGGGYGTKYWSRRSSQEWRCVNDKTRTQRIQLQCQDGSIRTYKITVVTACKCKRYTRQHNESSHNFEGTSQAKPVQHHKERKRASKSSKHSTS

SOSTDC1

Sclerostin domain-containing protein 1

206 amino acids

May be involved in the onset of endometrial receptivity for implantation/sensitization for the decidual cell reaction Enhances Wnt signaling and inhibits TGF-beta signaling (By similarity). Directly antagonizes activity of BMP2, BMP4, BMP6 and BMP7 in a dose-dependent manner.

Belongs to the sclerostin family.

23.307 kDa

MLPPAIHFYLLPLACILMKSCLAFKNDATEILYSHVVKPVPAHPSSNSTLNQARNGGRHFSNTGLDRNTRVQVGCRELRSTKYISDGQCTSISPLKELVCAGECLPLPVLPNWIGGGYGTKYWSRRSSQEWRCVNDKTRTQRIQLQCQDGSTRTYKITVVTACKCKRYTRQHNESSHNFESMSPAKPVQHHRERKRASKSSKHSMS

Sostdc1

Sclerostin domain-containing protein 1

206 amino acids

May be involved in the onset of endometrial receptivity for implantation/sensitization for the decidual cell reaction. Enhances Wnt signaling and inhibits TGF-beta signaling (By similarity). Directly antagonizes activity of BMP2, BMP4, BMP6 and BMP7 in a dose-dependent manner.

Belongs to the sclerostin family.

23.174 kDa

MLPPAIHLSLIPLLCILMRNCLAFKNDATEILYSHVVKPVPAHPSSNSTLNQARNGGRHFSSTGLDRNSRVQVGCRELRSTKYISDGQCTSISPLKELVCAGECLPLPVLPNWIGGGYGTKYWSRRSSQEWRCVNDKTRTQRIQLQCQDGSTRTYKITVVTACKCKRYTRQHNESSHNFESVSPAKPAQHHRERKRASKSSKHSLS

SOSTDC1

Sclerostin domain-containing protein 1

206 amino acids

Directly antagonizes activity of BMP2, BMP4, BMP6 and BMP7 in a dose-dependent manner. Enhances Wnt signaling and inhibits TGF-beta signaling. May be involved in the onset of endometrial receptivity for implantation/sensitization for the decidual cell reaction (By similarity).

Belongs to the sclerostin family.

23.297 kDa

MLPPAIHFYLLPLACILMKSCLAFKNDATEILYSHVVKPVPAHPSSNSTLNQARNGGRHFSNTGLDRNTRVQVGCRELRSTKYISDGQCTSISPLKELVCAGECLPLSVLPNWIGGGYGTKYWSRRSSQEWRCVNDKTRTQRIQLQCQDGSTRTYKITVVTACKCKRYTRQHNESSHNFESMSPAKPVQHHRERKRASKSSKHSMS

Sostdc1

Sclerostin domain-containing protein 1

206 amino acids

Directly antagonizes activity of BMP2, BMP4, BMP6 and BMP7 in a dose-dependent manner (By similarity). May be involved in the onset of endometrial receptivity for implantation/sensitization for the decidual cell reaction. Enhances Wnt signaling and inhibits TGF-beta signaling.

Belongs to the sclerostin family.

23.136 kDa

MLPPAIHLSLIPLLCILMKNCLAFKNDATEILYSHVVKPVSAHPSSNSTLNQARNGGRHFSSTGLDRNSRVQVGCRELRSTKYISDGQCTSISPLKELVCAGECLPLPVLPNWIGGGYGTKYWSRRSSQEWRCVNDKTRTQRIQLQCQDGSTRTYKITVVTACKCKRYTRQHNESSHNFESVSPAKPAQHHRERKRASKSSKHSLS