SOH1

Mediator of RNA polymerase II transcription subunit 31

180 amino acids

Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors (By similarity).

Belongs to the Mediator complex subunit 31 family.

20.703 kDa

MQALPTILPPPPLPDDSEAPARTPEKHANLVRFQSELEFIQCLAHPQYLHELHIQGYLGKPAFLNYLKYLEYWREPQYVRFIIYPTCLVYLTLLQTELFRSRLGDMGFITELMRVGSRHHATWRVGKPAEDKQSEEKPAVSMAPLDDDEEEDEPERGQETKGKRKKKKSRSGNVGAGQAL

SOH1

Mediator of RNA polymerase II transcription subunit 31

180 amino acids

Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors (By similarity).

Belongs to the Mediator complex subunit 31 family.

20.703 kDa

MQALPTILPPPPLPDDSEAPARTPEKHANLVRFQSELEFIQCLAHPQYLHELHIQGYLGKPAFLNYLKYLEYWREPQYVRFIIYPTCLVYLTLLQTELFRSRLGDMGFITELMRVGSRHHATWRVGKPAEDKQSEEKPAVSMAPLDDDEEEDEPERGQETKGKRKKKKSRSGNVGAGQAL

soh1

Mediator of RNA polymerase II transcription subunit 31

162 amino acids

Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors (By similarity).

Belongs to the Mediator complex subunit 31 family.

17.935 kDa

MDQQPPVQPQQRPPPSLTNPRFTLELEFVSSLANPYYLSHLAVTYPNLLGISKSSDDSNTSTEGPDPEAQAFAAYLAYLYSYWKTPEYAQFLTHPGATLRALRLLQEESFRRDIIRPQVIEALAGNGLENVQGGQNVEAGDTGHNEGDQGTQQDKENIALKT

soh1

Mediator of RNA polymerase II transcription subunit 31

162 amino acids

Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors (By similarity).

Belongs to the Mediator complex subunit 31 family.

17.875 kDa

MDQQPLAHPQQRPPPSLKNPRFTLELEFVSSLANPYYLSHLAVTYPNLLGISKSSDDSNTGTEGPDPEAQAFAAYLAYLYSYWKTPEYAQFLTHPGATLRALRLLQEETFRRDIIRPQVIEALAGTGLEDGQGGQNVEAGDIGHNEGDQGTQQDKENIASKT

soh1

Mediator of RNA polymerase II transcription subunit 31

161 amino acids

Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors (By similarity).

Belongs to the Mediator complex subunit 31 family.

17.917 kDa

MDQQPGPVQQSSPPNLTNPRFTLELEFVSSLANPYYLSHLAVTYPNLLGISKSGDEGETSNESSDPEAKAFAAYLAYLYSYWKTPEYAQFLTHPGATLRALRLLQEETFRRDIIRPQVIEALAGTGVDEQGAQDTQEGEGEQKQNKEEDAQDAQENTESKT

soh1

Mediator of RNA polymerase II transcription subunit 31

160 amino acids

Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors (By similarity).

Belongs to the Mediator complex subunit 31 family.

17.513 kDa

MDPQPGDQAQQPPPPTLTHPRFTLELEFVSSLANPYYLSHLAVNYPNLLGINKSGDDNDTNDSGDPDAQAFAAYLAYLYSYWKTPEYAQFLTHPGATLRALRLLQEDTFRRDIIRPQVIEGLAGTGIENEQGGTEANNPGEAEGEQTKGTADQQDGSSKT

SOH1

Mediator of RNA polymerase II transcription subunit 31

160 amino acids

Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors (By similarity).

Belongs to the Mediator complex subunit 31 family.

18.521 kDa

MAEVATAEKPVTDGIQDGSEQPDRSLRFEAELEFVQSLANPQYLSYLAHNKYLESPEFLNYLSYLEYWREPKYARFLVYPNCLHVLKLLQYATFRKEISRPDFAKQLMDEFYYAWIKPSEAGVFGDDDTLEGLKREDSQAPPGQNVKMENKDGDGDVQMA

soh1

Mediator of RNA polymerase II transcription subunit 31

158 amino acids

Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors (By similarity).

Belongs to the Mediator complex subunit 31 family.

17.669 kDa

MAQPQNDQAQPPPATLTNPRFTLELEFVSSLANPYYLSHLAVNYPSLLGISKSGNENEVNDDNSDPDAEAFAAYLAYLYSYWKTPEYSQFLTHPGATLRALRLLQEEKFRRDIIRPQVIERLAGVDLNGEQSAAEAGEQNTEQNKGDRGNVENQHGKT

SOH1

Mediator of RNA polymerase II transcription subunit 31

153 amino acids

Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors (By similarity).

Belongs to the Mediator complex subunit 31 family.

17.241 kDa

MTLGAATANDPIDSTLASPSRDEQRRQANQAAFSRDLEFLSSLANPYYLNHLALSGALSSPSFKRYLKYLDYFRHPKYVKYLHYPQALHFLDLLQNEEEFRLACRDPAFAGEVMAKQIGHWATWRDPENAAGQEQDEAGEQGEARETTGGQTA

SOH1

Mediator of RNA polymerase II transcription subunit 31

152 amino acids

Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors (By similarity).

Belongs to the Mediator complex subunit 31 family.

16.992 kDa

MAQEAGLIPPPPHLSNPRFTLELEFVLSLANPYYISHLAVTYPHLLGISSQSTDNDDPSASSDAKAFAAYLAYLYDYWKRPEYVQFLTHPGATLRALRLLQEESFRKAVIRPQVIEALLGTTTEVDLHVESEEDREKNNEEQAEKGSNGATS

soh1

Mediator of RNA polymerase II transcription subunit 31

151 amino acids

Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors (By similarity).

Belongs to the Mediator complex subunit 31 family.

16.693 kDa

MEQPPPADQPQQPPPPTLTNPRFTLELEFVSSLANPYYLSHLAVTYPNLLGINKSGDDSDVNNDSTDPDAQGFAAYLAYLYSYWKTPEYAQFLTHPGATLRALRLLQEETFRRDIIRPDVIERLAGTDIAAEPVDPAAESGDQEGEQAKAS

SOH1

Mediator of RNA polymerase II transcription subunit 31

146 amino acids

Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors (By similarity).

Belongs to the Mediator complex subunit 31 family.

17.672 kDa

MSAQTDQPITEQQKKEQEQYTNLINSLPTRWEIELEFVQSLSNIPYVNYLAQNNYFNDENFINYLNYLQYWTQPEYSKFLVYPNCLHILKLLQDENFRKNIINQDFMNSLMNDMVKRWQSNANDQDENKEKEENKEVPEVRINGTN

SOH1

Mediator of RNA polymerase II transcription subunit 31

135 amino acids

Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors (By similarity).

Belongs to the Mediator complex subunit 31 family.

15.828 kDa

MEESLPKRWEIELEFVQSLANIQYLNHLAQNNYLSNPEFLNYIEYLNYWKEPEYSKYLVYPNCLHILTLLQNEEFRKNILIPDFMNTVMNDMVKRWQDQDSVFGVTPQSQLEGLNASNGDDTNQPSVEVNGSGSN

soh1

Mediator of RNA polymerase II transcription subunit 31

134 amino acids

Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors (By similarity).

Belongs to the Mediator complex subunit 31 family.

15.263 kDa

MASDPMSVNSSAREPPAPPGSGADEPKYGGYTRFELELEFVQALGNPLYLNHLASRKLLSNPAFIAYLDYLQYWSRPPYLKYITYPGPTLKNLELLQQEKFRQDIISPDLVERLRLEGMKAGIDWHRESFPSTA

SOH1

Mediator of RNA polymerase II transcription subunit 31

130 amino acids

Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors (By similarity).

Belongs to the Mediator complex subunit 31 family.

15.258 kDa

MSDNKEDSTVDNSNSTEEVPLPTRFEVELEFVQSLANIPYVTYLLTQQQLLWKDPKFKNYLKYLEYWCEPPYAQCIVYPNALFILKLLNGFMEKATVNEDGLLDGLEDLPKVIQLQGNQWMNEMVERWAN

SOH1

Mediator of RNA polymerase II transcription subunit 31

127 amino acids

Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors (By similarity).

Belongs to the Mediator complex subunit 31 family.

14.914 kDa

MSAKSSEPPFEPSSEGEQLPSRFEVELEFVQSLANIPYVTFLLTQHQIWQDPRFKAYLKYLEYWCEPPYTQFIVYPNCLFVLKLLNSFLDKAVENEDGILEGAEDLPKVIQMQGGEWMNQMVERWRG

SOH1

Mediator of RNA polymerase II transcription subunit 31

127 amino acids

Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. The Mediator complex, having a compact conformation in its free form, is recruited to promoters by direct interactions with regulatory proteins and serves for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. The Mediator complex unfolds to an extended conformation and partially surrounds RNA polymerase II, specifically interacting with the unphosphorylated form of the C-terminal domain (CTD) of RNA polymerase II. The Mediator complex dissociates from the RNA polymerase II holoenzyme and stays at the promoter when transcriptional elongation begins.

Belongs to the Mediator complex subunit 31 family.

14.741 kDa

MSSTNGNAPATPSSDQNPLPTRFEVELEFIQSLANIQYVTYLLTQQQIWKSPNFKNYLKYLEYWCNPPYSQCIVYPNCLFILKLLNGFMESAIVNEDGLLEGLDELPKIIQLQGPQWMNEMVERWAN

SOH1

Mediator of RNA polymerase II transcription subunit 31

124 amino acids

Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors (By similarity).

Belongs to the Mediator complex subunit 31 family.

14.794 kDa

MSQQASTELTIEEGELPTRFEIELEFVQSLANIPYVTYLLTQLQLWQDPKFKRYLKYLEYWHEPEYAQCIVYPNSLFVLKLLNTLFEGSTVNENGVLEGCEHVPRILQTQGTQWMNEMVERWRE

SOH1

Mediator of RNA polymerase II transcription subunit 31

115 amino acids

Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors (By similarity).

Belongs to the Mediator complex subunit 31 family.

13.382 kDa

MASPPAQERPDVPLHGGFTRFELELEFVQCLANPVYLNYLATQKYFDKPEFVAYLDYLQYFAEPKYIKFLHHPGPTLRALELLQQERFRQDIITPGLANKLQIEGQRNAVPSQKD

SOH1

Mediator of RNA polymerase II transcription subunit 31

103 amino acids

Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors (By similarity).

Belongs to the Mediator complex subunit 31 family.

12.743 kDa

MSGSRFERELEFVQLLCNPDYLRWLTREGHFESEEFRSYLRYLEYWRSPEYSRFLTYPQCLAVLEHLNSENINDMLSDENFFLALGEQQYFIWLNKHKEGWNK