SNU13

NHP2-like protein 1

128 amino acids

Involved in pre-mRNA splicing as component of the spliceosome. Binds to the 5'-stem-loop of U4 snRNA and thereby contributes to spliceosome assembly. The protein undergoes a conformational change upon RNA-binding.

Belongs to the eukaryotic ribosomal protein eL8 family.

14.174 kDa

MTEADVNPKAYPLADAHLTKKLLDLVQQSCNYKQLRKGANEATKTLNRGISEFIVMAADAEPLEIILHLPLLCEDKNVPYVFVRSKQALGRACGVSRPVIACSVTIKEGSQLKQQIQSIQQSIERLLV

SNU13

NHP2-like protein 1

128 amino acids

Involved in pre-mRNA splicing as component of the spliceosome (PubMed:28781166). Binds to the 5'-stem-loop of U4 snRNA and thereby contributes to spliceosome assembly (PubMed:10545122, PubMed:17412961). The protein undergoes a conformational change upon RNA-binding (PubMed:17412961).

Belongs to the eukaryotic ribosomal protein eL8 family.

14.174 kDa

MTEADVNPKAYPLADAHLTKKLLDLVQQSCNYKQLRKGANEATKTLNRGISEFIVMAADAEPLEIILHLPLLCEDKNVPYVFVRSKQALGRACGVSRPVIACSVTIKEGSQLKQQIQSIQQSIERLLV

SNU13

NHP2-like protein 1

128 amino acids

Involved in pre-mRNA splicing as component of the spliceosome. Binds to the 5'-stem-loop of U4 snRNA and thereby contributes to spliceosome assembly. The protein undergoes a conformational change upon RNA-binding.

Belongs to the eukaryotic ribosomal protein eL8 family.

14.174 kDa

MTEADVNPKAYPLADAHLTKKLLDLVQQSCNYKQLRKGANEATKTLNRGISEFIVMAADAEPLEIILHLPLLCEDKNVPYVFVRSKQALGRACGVSRPVIACSVTIKEGSQLKQQIQSIQQSIERLLV

Snu13

NHP2-like protein 1

128 amino acids

Involved in pre-mRNA splicing as component of the spliceosome. Binds to the 5'-stem-loop of U4 snRNA and thereby contributes to spliceosome assembly. The protein undergoes a conformational change upon RNA-binding.

Belongs to the eukaryotic ribosomal protein eL8 family.

14.174 kDa

MTEADVNPKAYPLADAHLTKKLLDLVQQSCNYKQLRKGANEATKTLNRGISEFIVMAADAEPLEIILHLPLLCEDKNVPYVFVRSKQALGRACGVSRPVIACSVTIKEGSQLKQQIQSIQQSIERLLV

Snu13

NHP2-like protein 1

128 amino acids

Involved in pre-mRNA splicing as component of the spliceosome. Binds to the 5'-stem-loop of U4 snRNA and thereby contributes to spliceosome assembly. The protein undergoes a conformational change upon RNA-binding.

Belongs to the eukaryotic ribosomal protein eL8 family.

14.174 kDa

MTEADVNPKAYPLADAHLTKKLLDLVQQSCNYKQLRKGANEATKTLNRGISEFIVMAADAEPLEIILHLPLLCEDKNVPYVFVRSKQALGRACGVSRPVIACSVTIKEGSQLKQQIQSIQQSIERLLV

snu13

NHP2-like protein 1

128 amino acids

Involved in pre-mRNA splicing as component of the spliceosome. Binds to the 5'-stem-loop of U4 snRNA and thereby contributes to spliceosome assembly. The protein undergoes a conformational change upon RNA-binding.

Belongs to the eukaryotic ribosomal protein eL8 family.

14.068 kDa

MTEPEVNPKAYPLADAQLTKTLLDLVQQSANYKQLRKGANEATKTLNRGIAEFIVMAADAEPLEIILHLPLLCEDKNVPYVFVRSKQALGRACGVSRPVIACSVTIKEGSQLKPQIQSVQQAIERLLV

snu13

NHP2-like protein 1

128 amino acids

Involved in pre-mRNA splicing as component of the spliceosome. Binds to the 5'-stem-loop of U4 snRNA and thereby contributes to spliceosome assembly. The protein undergoes a conformational change upon RNA-binding.

Belongs to the eukaryotic ribosomal protein eL8 family.

14.066 kDa

MTEPEVNPKAYPLADAQLTKTLLDLVQQAANYKQLRKGANEATKTLNRGIAEFIVMAADAEPLEIILHLPLLCEDKNVPYVFVRSKQALGRACGVSRPVIACAVTIKEGSQLKPQIQSLQQSIERLLV

SNU13

13 kDa ribonucleoprotein-associated protein

127 amino acids

Common component of the spliceosome and rRNA processing machinery. In association with the spliceosomal U4/U6.U5 tri-snRNP particle, required for splicing of pre-mRNA. In association with box C/D snoRNPs, required for processing of pre-ribosomal RNA (rRNA) and site-specific 2'-O-methylation of substrate RNAs. Essential for the accumulation and stability of U4 snRNA, U6 snRNA, and box C/D snoRNAs (By similarity).

Belongs to the eukaryotic ribosomal protein eL8 family.

13.706 kDa

MSSTPNPKAFPLADAALTQQILDVVQQASNMRQLKKGANEATKTLNRGISEFIIMAADCEPIEILLHLPLLCEDKNVPYVFVPSRVALGRACGVSRPVIAASITTNDASAIKSQIYAVKDKIETLLI

SNU13

13 kDa ribonucleoprotein-associated protein

127 amino acids

Common component of the spliceosome and rRNA processing machinery. In association with the spliceosomal U4/U6.U5 tri-snRNP particle, required for splicing of pre-mRNA. In association with box C/D snoRNPs, required for processing of pre-ribosomal RNA (rRNA) and site-specific 2'-O-methylation of substrate RNAs. Essential for the accumulation and stability of U4 snRNA, U6 snRNA, and box C/D snoRNAs (By similarity).

Belongs to the eukaryotic ribosomal protein eL8 family.

13.946 kDa

MSAQPNPKAFPLANAQLTNQILDLIQQAQHYKQLKKGANEATKTLNRGICEFIVMTADVEPIEIVLHLPLLCEDKNVPYVFLPSKTALGRACGVSRPVIAASVTTNEARELNAQIQAVKNEIEKLLI

SNU13

13 kDa ribonucleoprotein-associated protein

127 amino acids

Common component of the spliceosome and rRNA processing machinery. In association with the spliceosomal U4/U6.U5 tri-snRNP particle, required for splicing of pre-mRNA. In association with box C/D snoRNPs, required for processing of pre-ribosomal RNA (rRNA) and site-specific 2'-O-methylation of substrate RNAs. Essential for the accumulation and stability of U4 snRNA, U6 snRNA, and box C/D snoRNAs (By similarity).

Belongs to the eukaryotic ribosomal protein eL8 family.

13.946 kDa

MSAQPNPKAFPLANAQLTNQILDLIQQAQHYKQLKKGANEATKTLNRGICEFIVMTADVEPIEIVLHLPLLCEDKNVPYVFLPSKTALGRACGVSRPVIAASVTTNEARELNAQIQAVKNEIEKLLI

SNU13

13 kDa ribonucleoprotein-associated protein

126 amino acids

Common component of the spliceosome and rRNA processing machinery. In association with the spliceosomal U4/U6.U5 tri-snRNP particle, required for splicing of pre-mRNA. In association with box C/D snoRNPs, required for processing of pre-ribosomal RNA (rRNA) and site-specific 2'-O-methylation of substrate RNAs. Essential for the accumulation and stability of U4 snRNA, U6 snRNA, and box C/D snoRNAs (By similarity).

Belongs to the eukaryotic ribosomal protein eL8 family.

13.601 kDa

MSAPNPKAFPLADSALTQQILDVVQQSQNLRQLKKGANEATKTLNRGISEFIIMAADTEPIEILLHLPLLCEDKNVPYVFVPSKAALGRACGVSRPVIAASVTSNDASSIKNQIYGIKDKIETLLI

SNU13

13 kDa ribonucleoprotein-associated protein

126 amino acids

Common component of the spliceosome and rRNA processing machinery. In association with the spliceosomal U4/U6.U5 tri-snRNP particle, required for splicing of pre-mRNA. In association with box C/D snoRNPs, required for processing of pre-ribosomal RNA (rRNA) and site-specific 2'-O-methylation of substrate RNAs. Essential for the accumulation and stability of U4 snRNA, U6 snRNA, and box C/D snoRNAs (By similarity).

Belongs to the eukaryotic ribosomal protein eL8 family.

13.683 kDa

MSAPNPKAFPLADEKLSQQILDVVQQAANLRQLKKGANEATKTLNRGISEFIIMAADCEPIEILLHLPLLCEDKNVPYVFVPSRVALGRACGVSRPVIAASITTNDASAIKNQIYAVKDKIETLLI

SNU13

13 kDa ribonucleoprotein-associated protein

126 amino acids

Common component of the spliceosome and rRNA processing machinery. In association with the spliceosomal U4/U6.U5 tri-snRNP particle, required for splicing of pre-mRNA. In association with box C/D snoRNPs, required for processing of pre-ribosomal RNA (rRNA) and site-specific 2'-O-methylation of substrate RNAs. Essential for the accumulation and stability of U4 snRNA, U6 snRNA, and box C/D snoRNAs (By similarity).

Belongs to the eukaryotic ribosomal protein eL8 family.

13.661 kDa

MSAPNPKAFPLADSALTQQILDVVQQSQNLRQLKKGANEATKTLNRGISEFIIMAADTEPIEILLHLPLLCEDKNVPYVFVPSKTALGRACGVSRPVIAASVTTNEASAMKNQIYGIKDKIETLLI

SNU13

13 kDa ribonucleoprotein-associated protein

126 amino acids

Common component of the spliceosome and rRNA processing machinery. In association with the spliceosomal U4/U6.U5 tri-snRNP particle, required for splicing of pre-mRNA. In association with box C/D snoRNPs, required for processing of pre-ribosomal RNA (rRNA) and site-specific 2'-O-methylation of substrate RNAs. Essential for the accumulation and stability of U4 snRNA, U6 snRNA, and box C/D snoRNAs (By similarity).

Belongs to the eukaryotic ribosomal protein eL8 family.

13.607 kDa

MSAPNPKAFPLADATLSQQILDVVQQASNMRQLKKGANEATKTLNRGISEFIIMAADCEPIEILLHLPLLCEDKNVPYVFVPSRTALGRACGVSRPVIAASITTNDASAIKSQIYAVKDKIETLLI

SNU13

13 kDa ribonucleoprotein-associated protein

126 amino acids

Common component of the spliceosome and rRNA processing machinery. In association with the spliceosomal U4/U6.U5 tri-snRNP particle, required for splicing of pre-mRNA. In association with box C/D snoRNPs, required for processing of pre-ribosomal RNA (rRNA) and site-specific 2'-O-methylation of substrate RNAs. Essential for the accumulation and stability of U4 snRNA, U6 snRNA, and box C/D snoRNAs (By similarity).

Belongs to the eukaryotic ribosomal protein eL8 family.

13.738 kDa

MSAPNPKAFPLADATLTNQILDLIQQASHYKQLKKGANEATKTLNRGICEFIVMAADVEPIEIVLHLPLLCEDKNVPYVFVPSKTALGRACGVSRPVVSASVTTNEARELQSQIQTVKLAIERLLI

SNU13

13 kDa ribonucleoprotein-associated protein

126 amino acids

Common component of the spliceosome and rRNA processing machinery. In association with the spliceosomal U4/U6.U5 tri-snRNP particle, required for splicing of pre-mRNA. In association with box C/D snoRNPs, required for processing of pre-ribosomal RNA (rRNA) and site-specific 2'-O-methylation of substrate RNAs. Essential for the accumulation and stability of U4 snRNA, U6 snRNA, and box C/D snoRNAs (By similarity).

Belongs to the eukaryotic ribosomal protein eL8 family.

13.801 kDa

MSEPNPKAFPLADAALTQQILDIVQQATHLRQLKKGANEATKTLNRGISEFIIMAADAEPIEILLHLPLLCEDKNVPYIFVPSKVALGRACGVSRPVISASVTSNDASQLKDQIIQMKDKIERLLI

SNU13

13 kDa ribonucleoprotein-associated protein

126 amino acids

Common component of the spliceosome and rRNA processing machinery. In association with the spliceosomal U4/U6.U5 tri-snRNP particle, required for splicing of pre-mRNA. In association with box C/D snoRNPs, required for processing of pre-ribosomal RNA (rRNA) and site-specific 2'-O-methylation of substrate RNAs. Essential for the accumulation and stability of U4 snRNA, U6 snRNA, and box C/D snoRNAs.

Belongs to the eukaryotic ribosomal protein eL8 family.

13.569 kDa

MSAPNPKAFPLADAALTQQILDVVQQAANLRQLKKGANEATKTLNRGISEFIIMAADCEPIEILLHLPLLCEDKNVPYVFVPSRVALGRACGVSRPVIAASITTNDASAIKTQIYAVKDKIETLLI

snu13

13 kDa ribonucleoprotein-associated protein

125 amino acids

Common component of the spliceosome and rRNA processing machinery. In association with the spliceosomal U4/U6.U5 tri-snRNP particle, required for splicing of pre-mRNA. In association with box C/D snoRNPs, required for processing of pre-ribosomal RNA (rRNA) and site-specific 2'-O-methylation of substrate RNAs. Essential for the accumulation and stability of U4 snRNA, U6 snRNA, and box C/D snoRNAs (By similarity).

Belongs to the eukaryotic ribosomal protein eL8 family.

13.535 kDa

MSVNPKAFPLADSGLTQQILDLVQQASHYKQLRKGANEATKTLNRGISEFIVMAADTEPIEILLHLPLLCEDKNVPYVFVPSKAALGRACGVSRPVISASITTNEASDLLPQIQAIKLAIEKLLI