SIR2rp3

NAD-dependent protein deacylase SIR2rp3

244 amino acids

NAD-dependent lysine demalonylase, desuccinylase and deglutarylase that specifically removes malonyl, succinyl and glutaryl groups on target proteins. Has weak NAD-dependent protein deacetylase activity; however this activity may not be physiologically relevant in vivo.

Belongs to the sirtuin family. Class III subfamily.

26.883 kDa

MRRPNGMIAILTGAGISAESGISTFRDQNGLWENHRVEDVCTPAAFLKQPTVVQRFYNERRRALLSPEVKPNASHQALARLQREYKDGQVVIITQNIDDLHERAGSRQVLHMHGELLKVRCTATGRVFESREDVIHGESKCECCGVVETLRPHIVWFNEMPLYMDVIDEVVQNAGLFVAVGTSGNVYPAAGLVMIAKAHGAETLELNLEPSGNCRDFDRSVYGPASVIVPAWADEVLHGKGPAA

SIR2rp3

NAD-dependent protein deacylase SIR2rp3

243 amino acids

NAD-dependent lysine demalonylase, desuccinylase and deglutarylase that specifically removes malonyl, succinyl and glutaryl groups on target proteins. Has weak NAD-dependent protein deacetylase activity; however this activity may not be physiologically relevant in vivo.

Belongs to the sirtuin family. Class III subfamily.

26.775 kDa

MKACRCITILTGAGISAESGISTFRDSNGLWCNHHVEDVASPDAFIRNPALVQLFYNERRRNLLLSSVKPNKAHTALAKLEEELSGKGKVFIVTQNVDNLHERAGSKNVLHMHGELLKARCTATGNVFEWQKDIVGDVDRCPDCGFLGTLRPHIVWFGEMPLCMDEIESILSTTDLFVAIGTSGNVYPAAGFVKRAQFYGATTLELNLQEGSNSTLFQESIYGKASSIVPTWVDQVLKESLKK