SINHCAF

SIN3-HDAC complex-associated factor

222 amino acids

Subunit of the Sin3 deacetylase complex (Sin3/HDAC), this subunit is important for the repression of genes encoding components of the TGF-beta signaling pathway. Core component of a SIN3A complex (composed of at least SINHCAF, SIN3A, HDAC1, SAP30, RBBP4, OGT and TET1) present in embryonic stem (ES) cells and is essential to maintain the complex on chromatin.

Belongs to the SINHCAF family.

24.968 kDa

MFGFRKPKMYRSIEGCCICRAKSSSSRFTDSKRYEKDFQNCFGLHEARSGDICNACVLLVKRWKKLPAGSKKNWNHVVDARAGPSLKTTLKPKKMKTLSGSRIKSNQISKLQKEFKRHNSDAHSTTSSASPAQSPCYSNQSDEGSDTEMSAGSSRTPVFSFLDLTYWKRQKVCCGIIYKGRFGEVLIDTHLFKPCCSNKKSATEKPEQEGPQSPAISTQEEW

SINHCAF

SIN3-HDAC complex-associated factor

221 amino acids

Subunit of the Sin3 deacetylase complex (Sin3/HDAC), this subunit is important for the repression of genes encoding components of the TGF-beta signaling pathway (PubMed:22865885, PubMed:22984288). Core component of a SIN3A complex (composed of at least SINHCAF, SIN3A, HDAC1, SAP30, RBBP4, OGT and TET1) present in embryonic stem (ES) cells. Promotes the stability of SIN3A and its presence on chromatin and is essential for maintaining the potential of ES cells to proliferate rapidly, while ensuring a short G1-phase of the cell cycle, thereby preventing premature lineage priming (By similarity).

Belongs to the SINHCAF family.

24.852 kDa

MFGFHKPKMYRSIEGCCICRAKSSSSRFTDSKRYEKDFQSCFGLHETRSGDICNACVLLVKRWKKLPAGSKKNWNHVVDARAGPSLKTTLKPKKVKTLSGNRIKSNQISKLQKEFKRHNSDAHSTTSSASPAQSPCYSNQSDDGSDTEMASGSNRTPVFSFLDLTYWKRQKICCGIIYKGRFGEVLIDTHLFKPCCSNKKAAAEKPEEQGPEPLPISTQEW

Sinhcaf

SIN3-HDAC complex-associated factor

221 amino acids

Subunit of the Sin3 deacetylase complex (Sin3/HDAC), this subunit is important for the repression of genes encoding components of the TGF-beta signaling pathway (By similarity). Core component of a SIN3A complex (composed of at least SINHCAF, SIN3A, HDAC1, SAP30, RBBP4, OGT and TET1) present in embryonic stem (ES) cells. Promotes the stability of SIN3A and its presence on chromatin and is essential for maintaining the potential of ES cells to proliferate rapidly, while ensuring a short G1-phase of the cell cycle, thereby preventing premature lineage priming (PubMed:28554894).

Belongs to the SINHCAF family.

24.829 kDa

MFGFHKPKMYRSIEGCCICRAKSSSSRFTDSKRYEKDFQSCFGLHETRSGDICNACVLLVKRWKKLPAGSKKNWNHVVDARAGPSLKTTLKPKKVKTLSGNRMKSNQISKLQKEFKRHNSDAHSTTSSASPAQSPCYSNQSDEGSDTEMASSSNRTPVFSFLDLTYWKRQKICCGIIYKGRFGEVLIDTHLFKPCCSSKKAAAEKPEEQGPAPLPISTQEW

SINHCAF

SIN3-HDAC complex-associated factor

221 amino acids

Subunit of the Sin3 deacetylase complex (Sin3/HDAC), this subunit is important for the repression of genes encoding components of the TGF-beta signaling pathway. Core component of a SIN3A complex (composed of at least SINHCAF, SIN3A, HDAC1, SAP30, RBBP4, OGT and TET1) present in embryonic stem (ES) cells. Promotes the stability of SIN3A and its presence on chromatin and is crucial for maintaining the potential of ES cells to proliferate rapidly, while ensuring a short G1-phase of the cell cycle, thereby preventing premature lineage priming.

Belongs to the SINHCAF family.

24.88 kDa

MFGFHKPKMYRSIEGCCICRAKSSSSRFTDSKRYEKDFQSCFGLHETRSGDICNACVLLVKRWKKLPAGSKKNWNHVVDARAGPSLKTTLKPKKVKTLSGNRIKSNQISKLQKEFRRHNSDAHSTTSSASPAQSPCYSNQSDDGSDTEMASGSNRTPVFSFLDLTYWKRQKICCGIIYKGRFGEVLIDTHLFKPCCSNKKAAAEKPEEQGPEPLPISTQEW