SFI8

RxLR effector protein SFI8

100 amino acids

Effector that suppresses flg22-induced post-translational MAP kinase activation both tomato and Arabidopsis. The perception of highly conserved pathogen- or microbe-associated molecular patterns (PAMPs/MAMPs), such as flg22, triggers converging signaling pathways recruiting MAP kinase cascades and inducing transcriptional re-programming, yielding a generic antimicrobial response.

Belongs to the RxLR effector family.

10.752 kDa

MRSILYAVLAFAVLARSSAVAAFPIPDESRPLSKTSPDTGATRSLRVEAQEVIQSGRGDGYGGFWKNVFPSTNKIIKKPDIKISKLIAAAKKAKAKMTKS