SFH1

Phosphatidylinositol/phosphatidylcholine transfer protein SFH1

554 amino acids

Required for transport of secretory proteins from the Golgi complex (By similarity). Catalyzes the transfer of phosphatidylinositol and phosphatidylcholine between membranes in vitro. Plays a role in root hair tip elongation as a key regulator of polarized membrane trafficking. May promote the PtdIns(4,5)P2 synthesis and organization in root hair membrane.

Belongs to the SFH family.

63.287 kDa

MAETKPEIEMSEEERKIVKISSLKKKAINASNRFKNSFKKKGRRSSSRVMSVPIEDDIDAEDLQALDAFRQALILDELLPSKLDDLHMMLRFLRARKFDIEKAKQMWSDMIQWRKDFGADTIIEDFDFEEIDEVMKHYPQGYHGVDKEGRPVYIERLGQIDANKLLQVTTMDRYVKYHVKEFEKTFKVKFPSCSVAANKHIDQSTTILDVQGVGLKNFSKSARELLQRLCKIDNENYPETLNRMFIINAGSGFRLLWSTVKSFLDPKTTAKIHVLGNKYHSKLLEVIDASELPEFFGGACTCEDKGGCMRSDKGPWNDPEVLKIAINREAKCSPISEDEHKHVDQGRSTSGFESLERIKKKTDEDNVYEKQIATIDKSMDMAWLAKTQKAENFPISKGLECYVRKGAPKKGDGLLVGGVMAFVMGIVAMVRLSKDVPRKLTEAALYGNSVCYEESTKSKQNQGQFAAPVSSSEYMLMVKRMAELEDKCMFLDLKPAHVESEKEEKLQAALNRVQVLEQELTETKKALEEALVSQKEILAYIEKKKKKKKLFFGF

SFH1

Chromatin structure-remodeling complex subunit SFH1

442 amino acids

Part of the chromatin structure-remodeling complex (RSC) which is involved in transcription regulation and nucleosome positioning. RSC is responsible for the transfer of a histone octamer from a nucleosome core particle to naked DNA. The reaction requires ATP and involves an activated RSC-nucleosome intermediate. Remodeling reaction also involves DNA translocation, DNA twist and conformational change. As a reconfigurer of centromeric and flanking nucleosomes, RSC complex is required both for proper kinetochore function in chromosome segregation and, via a PKC1-dependent signaling pathway, for organization of the cellular cytoskeleton. This subunit is essential for mitotic growth and required for cell cycle progression (By similarity).

Belongs to the SNF5 family.

49.078 kDa

MSLVPQAYLSNFHNRVKNEDVPLFTAAQLSRNKRGKQVNYAEFDTDLLDEFIDKNDEDDLEDDVDDSDGRRRGGDYYDQVDGSDGGAAAAAATAAAAAGLGEDGGIGEGTPGSGDPGAVTGGTPAADTGPDGTNDGTAGTSNPSSELDRIKLNDLPDLESQDDSATPLALLKYPRIRETFVQSRIAISYKDLLGDSIQDPQQVDIESPIMVPIRLNVEFSGHKLADFFMWNLNDHSMTPEQFATILCQDLDFPVLSNPNNSPYTQIISMINEQLQEYETLASLQVPDLHVIINLTANLDSKLYDDTFEWNLNDDSLCPEQFAELVVQDLGLQREFVPAIAHSLHESLLKVKKDWLEGNLNLAHVENKAAFGYTSGIRLDIDTLGASWFPKVEVLSQWEIEKREIEKERNMRRLKRESAKVDDGRSRRRGKRRMDDLETTLRI

SFH1

Chromatin structure-remodeling complex subunit SFH1

441 amino acids

Part of the chromatin structure-remodeling complex (RSC) which is involved in transcription regulation and nucleosome positioning. RSC is responsible for the transfer of a histone octamer from a nucleosome core particle to naked DNA. The reaction requires ATP and involves an activated RSC-nucleosome intermediate. Remodeling reaction also involves DNA translocation, DNA twist and conformational change. As a reconfigurer of centromeric and flanking nucleosomes, RSC complex is required both for proper kinetochore function in chromosome segregation and, via a PKC1-dependent signaling pathway, for organization of the cellular cytoskeleton. This subunit is essential for mitotic growth and required for cell cycle progression (By similarity).

Belongs to the SNF5 family.

50.135 kDa

MGEKPNRIGRANISYINHDHIFLPSFQPSYPSRQLHPLISSQNKVHSSIVHLPKVASPSSPETQQHSQAPLFITHIMSGLPQALASGFAARVREGGTTLYINTTPMLRSARHNTAVNYAEFEEDFDANDFEDDDDDDQSQRESRDGSEEAEGDEDGTKKEEQDKFAGLKAPLVSNEPKRAAPPVRPVMYPQEVLEELSQVKEPTLIPIRVAVENIDVFRVQDFFLWDADEKILTPEQFATLTCADLDVPIGYSAQMSAQIKKQLAEYTAAPALPKDVEVHVIVELAVTVDKIVYEDKFEWDLSGEYATPQEFARTVVQDLGLGQEFYPAITYQLYETLGKLQKAWLERSIPLDVDNRAAFGLEAGLRVDQDNLGESWVPRVEEMTPEEMQKREMERDRSSRRLKRESARMAEVPYVDLDSLYSRKRRRRFDEDSRSGSPMW

SFH1

Chromatin structure-remodeling complex subunit SFH1

426 amino acids

Component of the chromatin structure-remodeling complex (RSC), which is involved in transcription regulation and nucleosome positioning. RSC is responsible for the transfer of a histone octamer from a nucleosome core particle to naked DNA. The reaction requires ATP and involves an activated RSC-nucleosome intermediate. Remodeling reaction also involves DNA translocation, DNA twist and conformational change. As a reconfigurer of centromeric and flanking nucleosomes, RSC complex is required both for proper kinetochore function in chromosome segregation and, via a PKC1-dependent signaling pathway, for organization of the cellular cytoskeleton. This subunit is essential for mitotic growth and required for cell cycle progression.

Belongs to the SNF5 family.

48.777 kDa

MSHQNQLIPQAYISNFHNRLTNEDDGIPIFTMAQQTRQHKRAKVVNYAEYDNDLFDEFNMNGSNFNNADTHYKDNAVSHENTPALTNGVTMDGSEYNVLENMNGADSIISNNKYDAGSNMVVESLSGLNSNNNASNGPSNKAQAQDIGNAVLPDLQDQHHNPFNILRYPKIRDTFINGKVVSPYRLNTDQETKANANSGEAIMIPITLDIEHMGHTIKDQFLWNYNDDSISPEEFASIYCKDLDMTSATLQTQIANIIKEQLKDLENIAATEIMSDLHVIINLTCNLQDRFFEDNFQWNLNDKSLTPERFATSIVQDLGLTREFIPLISQSLHETILKIKKDWVDGHLIQDHVPNDAAFGYLSGIRLDIDELGSNWCPRVEILTKEEIQKREIEKERNLRRLKRETDRLSRRGRRRLDDLETTMRM

sfh1

Chromatin structure-remodeling complex subunit sfh1

418 amino acids

Component of the chromatin structure remodeling complex (RSC), which is involved in transcription regulation and nucleosome positioning. Controls particularly membrane and organelle development genes.

Belongs to the SNF5 family.

46.839 kDa

MAQACKTTYSSRLKTGNTCLIQKNVAVSTRSHSSYTGRNSLRNVPAVNYAAFEQGEDFETPVETPEKEEEKFETDDRGLAVGRPTGNNIYPRFATKTRHIYVTDEQLKCAAEERDVYIPIRLDIELPNNYRLKDTFLWNMNEQVMTPDVFAQILCADLDLSTNVYGTQISSSIRAQIEEYAPVAEVPMPKGQEMLVVFNIQVQLAQLSYNDQVEWNLTSPLTPEEFSVLTCNDLGLSGESRPEIAYAIHECLLKLKKNACEGDLPDYDSDAVPGTKAGPRQDMDTLGALWQPVLETVSLEDAKKNENNRENLVKQWRREASKFGGFAADVSAERWRAAALGNLSQSETANLPSASVSDAQTLLEQERPRWRCRWCNVLGTGTFCVRRGPEGNKSLCNACGVAYAKTGQLPYWRKSLYT

SFH1

Chromatin structure-remodeling complex subunit SFH1

403 amino acids

Part of the chromatin structure-remodeling complex (RSC) which is involved in transcription regulation and nucleosome positioning. RSC is responsible for the transfer of a histone octamer from a nucleosome core particle to naked DNA. The reaction requires ATP and involves an activated RSC-nucleosome intermediate. Remodeling reaction also involves DNA translocation, DNA twist and conformational change. As a reconfigurer of centromeric and flanking nucleosomes, RSC complex is required both for proper kinetochore function in chromosome segregation and, via a PKC1-dependent signaling pathway, for organization of the cellular cytoskeleton. This subunit is essential for mitotic growth and required for cell cycle progression (By similarity).

Belongs to the SNF5 family.

44.819 kDa

MSNRAVPQGYLANLQFRIRSDNLPLLSTVQPSRGHKRGGRAVNYAEFDNELLEDFSNFPTFDIDSDSNDEEQSSASAGNDDPQANANGGEAAGVNGQGSGDGGSANTGAGRHGKSQLTAEMEKNYKTGVPDLNEQKDSLNVLRYQKIRESFQHGKIAVPYRLYVPPELSTGQQEAILIPITLNVEHGNNTISDAFVWNVNDTSISVEDFVTTYCNDLGLYGNVSLHSQIVSSINEQIQELENVASLVIPDLEVVVNLTCTIQGKFFEDYFQWNLSDKSLSPEKFALIIVADLGLAREFAPGIAHSLHEYLLHVKKEWAEGSLHQDTVPNEAAFGYLAGVRLNIDDLGAKWAPKVEYLTQEEIQKREIEKERNMRRLKRESDRMGGGARRGRRRLDDLELTMKM

SFH1

Chromatin structure-remodeling complex subunit SFH1

383 amino acids

Part of the chromatin structure-remodeling complex (RSC) which is involved in transcription regulation and nucleosome positioning. RSC is responsible for the transfer of a histone octamer from a nucleosome core particle to naked DNA. The reaction requires ATP and involves an activated RSC-nucleosome intermediate. Remodeling reaction also involves DNA translocation, DNA twist and conformational change. As a reconfigurer of centromeric and flanking nucleosomes, RSC complex is required both for proper kinetochore function in chromosome segregation and, via a PKC1-dependent signaling pathway, for organization of the cellular cytoskeleton. This subunit is essential for mitotic growth and required for cell cycle progression (By similarity).

Belongs to the SNF5 family.

43.707 kDa

MSQLLPQAYLTNFHNRIRNEDVPLFITAAPTRNHKRAKVVNYSEYDNDLLLDDFIEQDQNDDDEKVHSDNGKGEGEEVGHEDAVASNNNLPDLEQQDDPTGILRYPRIRETFLQSKIAVRYEQVLEAGVGGSGEAVGIAEDEGAGAYSSSSQPVVIPIRLNLEHNGHKIIDFFTWNLNDHSLTLEQFAQIYCQDLDFAHNLSLQNQIVAAINDQLQEYETLASVVVPDLHVIINLTCNLDSKLYEDNFEWNLNDQTLSPEQFAELVVQDLGLTREFMPAIAHALYESILKIKKDWLEGHLNPEHVANGAAFGCLSGIRLDIDTLGSNWCPKVEVLSQWEIEKREIEKERNMRRLKRESAKVDDRLARRRGKRRMDDLETTMRI