SERPINB10

Heterochromatin-associated protein MENT

410 amino acids

DNA-binding protein that promotes DNA condensation into transcriptionally inactive heterochromatin in terminally differentiated avian blood cells. Promotes tight packing of nucleosomes into spherical clusters by binding to linker DNA and subsequent oligomerization. Acts as a cysteine protease inhibitor towards CTSL (cathepsin L1) and CTSV (cathepsin L2), but does not inhibit serine proteases.

Belongs to the serpin family. Ov-serpin subfamily.

47.384 kDa

MEQVSASIGNFTVDLFNKLNETNRDKNIFFSPWSISSALALTYLAAKGSTAREMAEVLHFTEAVRAESSSVARPSRGRPKRRRMDPEHEQAENIHSGFKELLTAFNKPRNNYSLRSANRIYVEKTYALLPTYLQLSKKYYKAEPQKVNFKTAPEQSRKEINTWVEKQTESKIKNLLSSDDVKATTRLILVNAIYFKAEWEVKFQAEKTSIQPFRLSKNKSKPVKMMYMRDTFPVLIMEKMNFKMIELPYVKRELSMFILLPDDIKDGTTGLEQLERELTYERLSEWADSKMMTETLVDLHLPKFSLEDRIDLRDTLRNMGMTTAFTTNADFRGMTDKKDLAISKVIHQSFVAVDEKGTEAAAATAVIISFTTSVINHVLKFKVDHPFHFFIRHNKSKTILFFGRFCCPVE

SERPINB10

Serpin B10

397 amino acids

Protease inhibitor that may play a role in the regulation of protease activities during hematopoiesis and apoptosis induced by TNF. May regulate protease activities in the cytoplasm and in the nucleus (By similarity).

Belongs to the serpin family. Ov-serpin subfamily.

45.196 kDa

MDFLAKSINQFALEFSKKLAESAEGKNIFFSPWGISASLAMVYLGTKGTTAAQMAQVLQFSRDQDSKFCPDSEKKRKMEFNVGKPEEIYSDFQTLISEINSSSHACILKTANRIYGEKTFPFHKKYLEDVKTYFGAEPQSVNFIGASDQIRKEINSWVEKQTEGKILNLLPDDAVDPTTRMVLVNALYFKGVWEHQFLVQNTTEKSFKINKTTSKPVQMMSMKEKLQVFYIESPQAMGLQLYYESRDLSLLILLPEDVDGLDQLEKTITYEKLSEWTSADMMELCNVQLNLPKFKLEETYDLKSTLSSMGMSDAFNQSKADFSGMSSERNLFLSNVFHKCFVEINEQGTEAAAGTGSEVSVRMKLPSIEFNADHPFLFFIRHNKTNGILFYGRFCSP

SERPINB10

Serpin B10

397 amino acids

Protease inhibitor that may play a role in the regulation of protease activities during hematopoiesis and apoptosis induced by TNF. May regulate protease activities in the cytoplasm and in the nucleus (By similarity).

Belongs to the serpin family. Ov-serpin subfamily.

45.433 kDa

MDALATSINQFALELSQKLAESAQGKNIFFSAWSISASLAMVHLGAKGNTAAQMAQVLQFKRDQGVKSDPESEKKRKMEFNLSNSGEIHCNFQTLISEILKPNNDYILKTANATYSEKTYPFHNKYLEDVKTYFGAEPQSVNFVEASDQIRKEINSWVERQTEGKIQNLLSDDSVDSTTRMVLVNALYFKGIWEHQFLVQHTTEKPFRINETTSKPVQMMFMKEKLQIFHIEKPQALGLQLYYKSRDLSLFILLPEDINGLEQLEKAITYEKLNEWTSADMMEVYHVQLHLPKFKLEESYDLKSTLSSMGMRDAFSESKADFSGMSSARNLFLSNVFHKAFVEIDEQGTEAAAGSGSEISFRMKVPSIEFNANHPFLFFIRHNKTNNILFYGRFCSP

SERPINB10

Serpin B10

397 amino acids

Protease inhibitor that may play a role in the regulation of protease activities during hematopoiesis and apoptosis induced by TNF. May regulate protease activities in the cytoplasm and in the nucleus.

Belongs to the serpin family. Ov-serpin subfamily.

45.403 kDa

MDSLATSINQFALELSKKLAESAQGKNIFFSSWSISTSLTIVYLGAKGTTAAQMAQVLQFNRDQGVKCDPESEKKRKMEFNLSNSEEIHSDFQTLISEILKPNDDYLLKTANAIYGEKTYAFHNKYLEDMKTYFGAEPQPVNFVEASDQIRKDINSWVERQTEGKIQNLLPDDSVDSTTRMILVNALYFKGIWEHQFLVQNTTEKPFRINETTSKPVQMMFMKKKLHIFHIEKPKAVGLQLYYKSRDLSLLILLPEDINGLEQLEKAITYEKLNEWTSADMMELYEVQLHLPKFKLEDSYDLKSTLSSMGMSDAFSQSKADFSGMSSARNLFLSNVFHKAFVEINEQGTEAAAGSGSEIDIRIRVPSIEFNANHPFLFFIRHNKTNTILFYGRLCSP

Serpinb10

Serpin B10

397 amino acids

Protease inhibitor that may play a role in the regulation of protease activities during hematopoiesis and apoptosis induced by TNF. May regulate protease activities in the cytoplasm and in the nucleus (By similarity).

Belongs to the serpin family. Ov-serpin subfamily.

45.115 kDa

MASLAVSINQFALEFSKKLAESAEGRNIFFSPWGISTALAMLYLGTKGTTADQMAQVLQFSSVEDFKSCPDSEKKRKMEFNSGKFEEIQSDFQTLAAEILKPGNSYVLKTANRIYGEKTYPFHNKYLEDMKTYFGAEPQSVNFVEASGQIRKEINSWVGSQTGGKIPNLLPDDSVDTKTKMVLVNALYFKGTWEHQFSVKNTTERPFRVNKTTSKPVQMMSMKQSLQVFHIEELQTIGLQLHYQNRDLSLLLLLPEAIDGLEQLERAITYEKLDKWTSADMMDTYEVQLYLPKFKMEESYDLKSALRGMGMTDVFSQSKADFSNMTSERNLFLSNVFHKTFLEINEEGTEAAAGTGSEISVRIKAPSIELNVDHPFLFFIRHNKTKSILFCGRFCSP

SERPINB10

Serpin B10

397 amino acids

Protease inhibitor that may play a role in the regulation of protease activities during hematopoiesis and apoptosis induced by TNF. May regulate protease activities in the cytoplasm and in the nucleus (By similarity).

Belongs to the serpin family. Ov-serpin subfamily.

45.124 kDa

MDPLASSISQFALEFSKELAASAAGKNIFFSPWSISSALAMVYLGARGTTAVEMAKVLQLNRDQADKTGPESEKKRKMEFNLGKAEEIHCDFQTLISEILKPTDAHVLKTANGIYGEKTYPFHNKYLEEVKTYFGAEPQSVNFVEASDQIRKEINSWVESQTQGKILNLLPDDSVDSTTRMILVNALYFKGTWEHQFLAQNTTEKPFRINETTSKPVQMMSMKEKLHVFHIEKPQATGLQLYYERRDVSLFILLPEDLGGLEQLEKAITYEKLNEWTSADMMELYDVQLSLPKFKLEESYDLKSTLSSMGMSDAFNPSKADFSGMSLERNLYLSNIFHKVFVEINEEGTEAAAGTGSEVGFRIKYPSIEFNVDHPFLFFIRHNKTNSILFYGRFCSP

SERPINB10

Serpin B10

397 amino acids

Protease inhibitor that may play a role in the regulation of protease activities during hematopoiesis and apoptosis induced by TNF. May regulate protease activities in the cytoplasm and in the nucleus (By similarity).

Belongs to the serpin family. Ov-serpin subfamily.

45.383 kDa

MDTLATSINQFALELSKKLAESAQGKNIFFSSWSISTSLAMVYLGTKGTTAAQMGQVLQFNRDQGVKSSPESEKKRKMEFNSSNSEEIHSDFHTLISEILKPNDDYLLKTANAIYGEKTYPFHNKYLEDMKTYFGAEPQSVNFVEASDQIRKEINSWVERQTEGKIQNLLPDDSVDSTTRMILVNALYFKGIWEHQFLVQNTTEKPFRINETTSKPVQMMFMKKKLQIFHIEKPQAVGLQLYYKSRDLSLLILLPEDINGLVQLEKDITYEKLNEWTSADMMELYEVQLHLPKFKLEDSYDLKSTLSSMGMSDAFSQSKADFSGMSSARNLFLSNVFHKAFVEINEQGTEAAAGTGSEIESRIRVPSIEFNANHPFLFFIRHNKTNSILFYGRLCSP

SERPINB10

Serpin B10

397 amino acids

Protease inhibitor that may play a role in the regulation of protease activities during hematopoiesis and apoptosis induced by TNF. May regulate protease activities in the cytoplasm and in the nucleus (By similarity).

Belongs to the serpin family. Ov-serpin subfamily.

45.102 kDa

MDALATSINQFALELSKKLAESAQGKNIFFSAWSISASLAMVHLGAKGNTAAQMAQVLQFKRDQGVKSDPESEKKRKTEFNLSNSGEIHCNFQTLISEILKPNNDYILKTANAAYSEKTYPFHNKYLEDVKTYFGAEPQSVNFVEASDQIRKEINSWVERQTEGKIQNLLSDDSVGSTTRMVLVNALYFKGIWEHQFLVQNTTEKPFRINETTSKPVQMMFMKEKLQIFHIEKPQALGLQLYYKSCDLSLFILLPEDINGLEQLEKAITYEKLSKWTSADMMEVYDVQLHLPKFKLEESYDLKSTLSSMGMSDAFSESEADFSGMSSARNLFLSNVFHKAFVEIDEQGTEAAAGSGSEISFRIKVPSIEFNANHPFLFFIRHNKTNNILFYGRFCSP

Serpinb10

Serpin B10

397 amino acids

Protease inhibitor that may play a role in the regulation of protease activities during hematopoiesis and apoptosis induced by TNF. May regulate protease activities in the cytoplasm and in the nucleus (By similarity). Inhibits plasmin.

Belongs to the serpin family. Ov-serpin subfamily.

45.387 kDa

MASLAVSINQFAVEFSKKLAESAEGRNIFFSPWGISTSLAMVYLGTKGTTAAQMSQVLHFGSIQDFKFGPDSEKKRKMECHSGKSEEMQSDFQTLTAKILKHGNSYVLKIANRIYVEKTYLFHNKYLEDMKTYFGAEPQSVNFVEASGQIRKEINSWVGSQTGDKIPNLLPDDAVDNKTTMVLVNALYFKGTWEHQFSVQNTTERPFRINKTTSKPVQMMSMKQSLQVFHIEELQTIGVQLHYQNREFSLLLLLPEEVEGLKQLERAITYEKLDKWTSADMMDTYEVRLYLPKFKMEESYDLQSALRDMGMTDAFNQGKANFSNMTSERNLFLSNVFHKTFLEINEEGTEAAAGTGSEVNFRIKAPSIELNADHPFLFLIRHNVTNTILFDGRFYSP

SERPINB10

Serpin B10

397 amino acids

Protease inhibitor that may play a role in the regulation of protease activities during hematopoiesis and apoptosis induced by TNF. May regulate protease activities in the cytoplasm and in the nucleus (By similarity).

Belongs to the serpin family. Ov-serpin subfamily.

45.401 kDa

MDSLTKSINQFALEFSKKLAESAEGKNIFFSPWGISTSLAMVYLGTRGTTAAQIAQVLQFNRDQDSKFFPESEKKRKMDFNSRKVEEIRSDFQTLISEINNPSNAYVLKTANGIYGEKTYPFHNKYLEDMKTYFGVEPQSVNFLEAPDQTRNEINSWVESQTQGKILNLLPDDAVDSATRMVLVNAIYFKGIWEHQFSARDTREKPFRINKNTSKPVQMMSMKKKLQVFHIENPQAIGLQLYYESRDLSLFLLLPEDVSGLDQLEKAVTYEKLSEWTSADMMELYDVQLHLPKFKLEESYDLKSALSSMGMSDAFNQSKADFSGMSVEGNLFLSNVFHKSFVEINEQGTEASAGTGSEVSLRIRLPSIEFNADHPFLFFIRHNKTNSILFYGRFCSP

SERPINB10

Serpin B10

397 amino acids

Protease inhibitor that may play a role in the regulation of protease activities during hematopoiesis and apoptosis induced by TNF. May regulate protease activities in the cytoplasm and in the nucleus (By similarity).

Belongs to the serpin family. Ov-serpin subfamily.

45.169 kDa

MDSLANSINQFALEFSKKLAETDEGKNIFFSPWGISTTLAMVYLGTKGTTATQMAQVLQFDTDQDVKSSPENEKKRKVDLNSDQVGEIHFGFQKLISEINNPSNTYVLKTANGIYGEKTYPFHNKYIEDIKTYFGAKPQSVNFVEDSDQIRKDINSWVESQTEGKIPNLLPDDAVDSATKMVLVNALYFKGLWEHQFSVQDTTEKPFRINKTSSKPVQMMSMKKNLEVFHIEKPQATGLRLDYKNRDLSLLLILPEDVCGLDQLEKAITYDQLSEWTSEDMMEMYTVELHLPKFKLEQSYDLKTTLASMGMSDAFNQSKADFSGMSDERNLYLSNVFHKSFVEINEQGTEAAAGSASEISVRIKLPTIEINADHPFIFFIRHNKTNSILFYGRFCSP