SERPINB1

Leukocyte elastase inhibitor

379 amino acids

Neutrophil serine protease inhibitor that plays an essential role in the regulation of the innate immune response, inflammation and cellular homeostasis. Acts primarily to protect the cell from proteases released in the cytoplasm during stress or infection. These proteases are important in killing microbes but when released from granules, these potent enzymes also destroy host proteins and contribute to mortality. Regulates the activity of the neutrophil proteases elastase, cathepsin G, proteinase-3, chymase, chymotrypsin, and kallikrein-3. Acts also as a potent intracellular inhibitor of GZMH by directly blocking its proteolytic activity. During inflammation, limits the activity of inflammatory caspases CASP1, CASP4 and CASP5 by suppressing their caspase-recruitment domain (CARD) oligomerization and enzymatic activation. When secreted, promotes the proliferation of beta-cells via its protease inhibitory function.

Belongs to the serpin family. Ov-serpin subfamily.

43.006 kDa

MEQLSTANTHFAVDLFRALNESDPTGNIFISPLSISSALAMIFLGTRGNTAAQVSKALYFDTVEDIHSRFQSLNADINKPGAPYILKLANRLYGEKTYNFLADFLASTQKMYGAELASVDFQQAPEDARKEINEWVKGQTEGKIPELLVKGMVDNMTKLVLVNAIYFKGNWQEKFMKEATRDAPFRLNKKDTKTVKMMYQKKKFPYNYIEDLKCRVLELPYQGKELSMIILLPDDIEDESTGLEKIEKQLTLEKLREWTKPENLYLAEVNVHLPRFKLEESYDLTSHLARLGVQDLFNRGKADLSGMSGARDLFVSKIIHKSFVDLNEEGTEAAAATAGTIMLAMLMPEENFNADHPFIFFIRHNPSANILFLGRFSSP

SERPINB1

Leukocyte elastase inhibitor

379 amino acids

Neutrophil serine protease inhibitor that plays an essential role in the regulation of the innate immune response, inflammation and cellular homeostasis (PubMed:30692621). Acts primarily to protect the cell from proteases released in the cytoplasm during stress or infection. These proteases are important in killing microbes but when released from granules, these potent enzymes also destroy host proteins and contribute to mortality. Regulates the activity of the neutrophil proteases elastase, cathepsin G, proteinase-3, chymase, chymotrypsin, and kallikrein-3 (PubMed:11747453, PubMed:30692621). Acts also as a potent intracellular inhibitor of GZMH by directly blocking its proteolytic activity (PubMed:23269243). During inflammation, limits the activity of inflammatory caspases CASP1, CASP4 and CASP5 by suppressing their caspase-recruitment domain (CARD) oligomerization and enzymatic activation (PubMed:30692621). When secreted, promotes the proliferation of beta-cells via its protease inhibitory function (PubMed:26701651).

Belongs to the serpin family. Ov-serpin subfamily.

42.742 kDa

MEQLSSANTRFALDLFLALSENNPAGNIFISPFSISSAMAMVFLGTRGNTAAQLSKTFHFNTVEEVHSRFQSLNADINKRGASYILKLANRLYGEKTYNFLPEFLVSTQKTYGADLASVDFQHASEDARKTINQWVKGQTEGKIPELLASGMVDNMTKLVLVNAIYFKGNWKDKFMKEATTNAPFRLNKKDRKTVKMMYQKKKFAYGYIEDLKCRVLELPYQGEELSMVILLPDDIEDESTGLKKIEEQLTLEKLHEWTKPENLDFIEVNVSLPRFKLEESYTLNSDLARLGVQDLFNSSKADLSGMSGARDIFISKIVHKSFVEVNEEGTEAAAATAGIATFCMLMPEENFTADHPFLFFIRHNSSGSILFLGRFSSP

SERPINB1

Leukocyte elastase inhibitor

378 amino acids

May be cleaved leading to a loss of its anti-protease activity and to the appearance of an endonuclease activity. However no catalytic site was identified.

Belongs to the serpin family. Ov-serpin subfamily.

42.513 kDa

MEQLSAANTRFALDLFRALNESNPAGNIFISPFSISSALAMILLGTRGNTEAQMSKALHFDTVKDIHSRFQSLNADINKCGASYILKLANRLFGEKTYHFLPEFLASTQKTYGAELASVDFLRASEEARKAINEWVKEQTEGKIPELLASGVVDSATKLVLVNAIYFKGSWQEKFMTEATKDAPFRLNKKDSKTVKMMYQKKKFPFGYIKELKCRVLELPYQGKDLSMVILLPDSIEDESTGLRKIEQHLTLEKLNEWTKPDNLELLEVNVHLPRFRLEESYDLNAPLARLGVQDLFGSRADLTGMSEARDLFISKVVHKAFVEVNEEGTEAAAATAGIAVFAMLMPEEDFIADHPFIFFIRHNPSSNILFLGRLSSP

SERPINB1

Leukocyte elastase inhibitor

377 amino acids

Neutrophil serine protease inhibitor that plays an essential role in the regulation of the innate immune response, inflammation and cellular homeostasis. Acts primarily to protect the cell from proteases released in the cytoplasm during stress or infection. These proteases are important in killing microbes but when released from granules, these potent enzymes also destroy host proteins and contribute to mortality. Regulates the activity of the neutrophil proteases elastase, cathepsin G, proteinase-3, chymase, chymotrypsin, and kallikrein-3. Acts also as a potent intracellular inhibitor of GZMH by directly blocking its proteolytic activity. During inflammation, limits the activity of inflammatory caspases CASP1, CASP4 and CASP5 by suppressing their caspase-recruitment domain (CARD) oligomerization and enzymatic activation. When secreted, promotes the proliferation of beta-cells via its protease inhibitory function.

Belongs to the serpin family. Ov-serpin subfamily.

42.236 kDa

MEQLSAANTRFAVDLFLTLTEHNPAGNIFISPFSISSALAMVFLGARGDTAAQMSKALHFEGVEIHSGFQSLNADINKCGAPYTLKLANRLFGEKSYDFLPEFLASTQEMYSAELASVDFLRAPEDARKTINAWVKEQTGGKIPELLASGMVDSLTKLVLVNAIYFKGKWQEKFMVEATKDAPFRLNKKETKTVKMMYQKKKFPFGYIKDLKCRVLELPYEGKDLSMVILLPDDIQDEATGLKKIEQQLTLEKLREWTRPESLDLLEVRVQLPRFKLEESYDLQEPLARLGVRDLFSSKADLSGMSGAKDLFISKVVHKSVVDVNEEGTEAAAATGAIAEFAMLVPEEEFVADHPFIFFIRHKPSSNILFLGRLSSP

serpinb1

Leukocyte elastase inhibitor

377 amino acids

Regulates the activity of the neutrophil proteases.

Belongs to the serpin family. Ov-serpin subfamily.

42.698 kDa

MENLSSACTHFCFDLFKKINENNSTGNLFFSPISLSTALAMVFLGTKGKTAEQMSKTLHFDAVKDLHSNFQTLNAEINKKDVSTYALNLANRLFGEKTFNFLPNFLSSVKKQYSADLGTVDFISALEDARKEINKWVSEQTKGKIPEVLSTGTVDRSTKLVLVNAIYFKGDWAKKFNAEHTTDMPFQLNKKEQKTVKMMYQKEKLPFNYIPDINCRILELPYVDYELSMIIILPDNINDDTTGLQQLEKELSLEKIHEWTENMMPTDVHIHLPKFKLEDSYKLKSQLAGMGMVDLFNSGSADLSGMSGSNNLFLSEVIHKSFVEVNEEGTEAAAASAGIAMMCMMREEEFNADHPFLFLIRHNATKSILFFGRYSSP

serpinb1

Leukocyte elastase inhibitor

377 amino acids

Regulates the activity of the neutrophil proteases.

Belongs to the serpin family. Ov-serpin subfamily.

42.519 kDa

MENLSSACTHFSFDLFRKINENNATGNVFFSPISISTALAMVLLGARGNTAQQISRILHFDAVKDLHSNFQTLNAEINKKNVSSYALNLANRLFGEKSFKFLPDFLSSVKKQYNADLGTVDFISAAEDARKEINTWVSEQTKGKIPEVLSAGAVNSFTKLVLVNAIYFKGDWAKKFKAEHTKDMPFQLNKKEQKTVKMMYQMEKLPFNYIPEINCRVLELPYVDYELSMVIVLPDNINDDTTGLQQLEKELSLEKINEWTENMMPIDVHVHLPKFKLEDSYKLKSQLAGMGMADLFEAGSADLSGMSGSNDLYLSEVIHKSFVEVNEEGTEAAAASAGIAMMCLMREEEFNANHPFLFFIRHNATKSILFFGRYSSP