serP1

Serine permease SerP1

459 amino acids

Transports L-serine, L-threonine and L-cysteine with high affinity (PubMed:23144255, PubMed:25535271). Stereoselective, with a strong preference for L-serine. Is the main L-serine transporter and is responsible for optimal growth in media containing free amino acids as the sole source of amino acids. Is also the main transporter for L-threonine (PubMed:25535271).

Belongs to the amino acid-polyamine-organocation (APC) superfamily. Amino acid transporter (AAT) (TC 2.A.3.1) family.

51.331 kDa

MEDIQKNHEAQRGLQNRHIQLIAIAGTIGTGLFLGAGKTIQMTGPSVIFAYILIGIAMFFFLRTIGEMLYNDPSQHSFLNFVTKYSGIRTGYFTQWSYWLVIVFVCISELTAIGTYIQFWLPHLPLWLIEIVMLALLFGLNTLNSRFFGETEFWFAMIKVAAILGMIVTAIILVASNFHYTTVLSGKTVNDTASLNNIFDGFQLFPHGAWNFVGALQMVMFAFTSMEFIGMTAAETVNPKKSLPKAINQIPVRILLFYVGALLAIMAIFNWHYIPADKSPFVIVFQLIGIKWAAALINFVVLTSAASALNSSLFSATRNMYSLAKQHDKGRLTAFTKLSKAGIPINALYMATALSLLAPVLTLIPQIKNAFNFAASCTTNLFLVVYFITLYTYWQYRKSDDYNPNGFLTPKPTIAVPFIAIIFAIVFASLFFNADTFYPALGAIVWTLIFGLYSHFKKI

SERP1

Stress-associated endoplasmic reticulum protein 1

66 amino acids

Interacts with target proteins during their translocation into the lumen of the endoplasmic reticulum. Protects unfolded target proteins against degradation during ER stress. May facilitate glycosylation of target proteins after termination of ER stress. May modulate the use of N-glycosylation sites on target proteins (By similarity).

Belongs to the RAMP4 family.

7.374 kDa

MVAKQRIRMANEKHSKNITQRGNVAKTSRNAPEEKASVGPWLLALFIFVVCGSAIFQIIQSIRMGM

SERP1

Stress-associated endoplasmic reticulum protein 1

66 amino acids

Interacts with target proteins during their translocation into the lumen of the endoplasmic reticulum. Protects unfolded target proteins against degradation during ER stress. May facilitate glycosylation of target proteins after termination of ER stress. May modulate the use of N-glycosylation sites on target proteins (By similarity).

Belongs to the RAMP4 family.

7.374 kDa

MVAKQRIRMANEKHSKNITQRGNVAKTSRNAPEEKASVGPWLLALFIFVVCGSAIFQIIQSIRMGM

Serp1

Stress-associated endoplasmic reticulum protein 1

66 amino acids

Interacts with target proteins during their translocation into the lumen of the endoplasmic reticulum. Protects unfolded target proteins against degradation during ER stress. May facilitate glycosylation of target proteins after termination of ER stress. May modulate the use of N-glycosylation sites on target proteins (By similarity).

Belongs to the RAMP4 family.

7.374 kDa

MVAKQRIRMANEKHSKNITQRGNVAKTSRNAPEEKASVGPWLLALFIFVVCGSAIFQIIQSIRMGM

SERP1

Stress-associated endoplasmic reticulum protein 1

66 amino acids

Interacts with target proteins during their translocation into the lumen of the endoplasmic reticulum. Protects unfolded target proteins against degradation during ER stress. May facilitate glycosylation of target proteins after termination of ER stress. May modulate the use of N-glycosylation sites on target proteins (By similarity).

Belongs to the RAMP4 family.

7.302 kDa

MVAKQRIRMANEKHSKNITQRGNVAKTSRNAPGEKASVGPWLLALFIFVVCGSAIFQIIQSIRMGM

Serp1

Stress-associated endoplasmic reticulum protein 1

66 amino acids

Interacts with target proteins during their translocation into the lumen of the endoplasmic reticulum. Protects unfolded target proteins against degradation during ER stress. May facilitate glycosylation of target proteins after termination of ER stress. May modulate the use of N-glycosylation sites on target proteins.

Belongs to the RAMP4 family.

7.374 kDa

MVAKQRIRMANEKHSKNITQRGNVAKTSRNAPEEKASVGPWLLALFIFVVCGSAIFQIIQSIRMGM