About Products Protein Database Contact

SERP0585

Gene
SERP0585
Protein
UPF0738 protein SERP0585
Organism
Staphylococcus epidermidis (strain ATCC 35984 / RP62A)
Length
115 amino acids
Similarity
Belongs to the UPF0738 family.
Mass
13.562 kDa
Sequence
MRIYINEIKLKDDGVYCFSEESTEGLEEVGQMLVDSDNYGFAYLLDDGQSYSYLIFVQETWSMLHENRDKKIIINNHLELKHFQEELDYVLNNIEGNNNYGKEFVSAVEKTFELE