About Products Protein Database Contact

SEQ_0368

Gene
SEQ_0368
Protein
Nucleoid-associated protein SEQ_0368
Organism
Streptococcus equi subsp. equi (strain 4047)
Length
99 amino acids
Function
Binds to DNA and alters its conformation. May be involved in regulation of gene expression, nucleoid organization and DNA protection.
Similarity
Belongs to the YbaB/EbfC family.
Mass
10.9 kDa
Sequence
MMNMQNMMKQAQKLQKQMEQKQADLAAMQFTGKSAQELVTATFTGDKQLVSIDFKEAVVDPEDIETLQDMTAQAINAALAQIDEATKKTLGAFAGKLPF