sen15

Probable tRNA-splicing endonuclease subunit sen15

143 amino acids

Non-catalytic subunit of the tRNA-splicing endonuclease complex, a complex responsible for identification and cleavage of the splice sites in pre-tRNA. It cleaves pre-tRNA at the 5' and 3' splice sites to release the intron. The products are an intron and two tRNA half-molecules bearing 2',3' cyclic phosphate and 5'-OH termini. There are no conserved sequences at the splice sites, but the intron is invariably located at the same site in the gene, placing the splice sites an invariant distance from the constant structural features of the tRNA body (By similarity).

Belongs to the SEN15 family.

16.467 kDa

MQHNTFLPNDAVEEQKQNPYYGILRAVETDLRLGQRWCELKVHVLDIDLKTKRPLLSGIPVNGQLKDKLQYVLPLYLQETISIEFLSSVFDSMKKLSLPLVKDARGLSGDEFFLYLGIMCSDSTIVYYKITDGLIKPRQNDEE

SEN15

tRNA-splicing endonuclease subunit SEN15

128 amino acids

Non-catalytic subunit of the tRNA-splicing endonuclease complex, a complex responsible for identification and cleavage of the splice sites in pre-tRNA. It cleaves pre-tRNA at the 5' and 3' splice sites to release the intron. The products are an intron and two tRNA half-molecules bearing 2',3' cyclic phosphate and 5'-OH termini. There are no conserved sequences at the splice sites, but the intron is invariably located at the same site in the gene, placing the splice sites an invariant distance from the constant structural features of the tRNA body.

Belongs to the SEN15 family.

14.89 kDa

MATTDIISLVKNNLLYFQMWTEVEILQDDLSWKGNSLRLLRGRPPHKLSNDVDTEHENSLSSPRPLEFILPINMSQYKENFLTLECLSQTFTHLCSPSTERILLAIINDDGTIVYYFVYKGVRKPKRN

SEN15

tRNA-splicing endonuclease subunit SEN15

118 amino acids

Non-catalytic subunit of the tRNA-splicing endonuclease complex, a complex responsible for identification and cleavage of the splice sites in pre-tRNA. It cleaves pre-tRNA at the 5' and 3' splice sites to release the intron. The products are an intron and two tRNA half-molecules bearing 2',3' cyclic phosphate and 5'-OH termini. There are no conserved sequences at the splice sites, but the intron is invariably located at the same site in the gene, placing the splice sites an invariant distance from the constant structural features of the tRNA body (By similarity).

Belongs to the SEN15 family.

13.189 kDa

MSVSYNGGLTGLTALVRNNLVHYQQWSDVEVVPLRDREALRGRPAQKLSNDDEEIGVEYVLPVELSQYRSSGVTLEALDKVFSQLPASCKRVVLAISSDDGTVVYYTVYQGLQRPRKN