SEH1

Nucleoporin SEH1

538 amino acids

Functions as a component of the nuclear pore complex (NPC). NPC components, collectively referred to as nucleoporins (NUPs), can play the role of both NPC structural components and of docking or interaction partners for transiently associated nuclear transport factors. Involved in nuclear poly(A)+ RNA export and NPC biogenesis.

Belongs to the WD repeat SEC13 family.

58.97 kDa

MSKAAAFLTDPPLVDDRPSFETILKHGHQDLVQAVAFNGHGDRCATGSVDGKIRVFNRLKEGIWRLCDNWTAHAGEILELQWLPTTVYPNLLASLGIEGRFKLWAEDPSAAPGRRFAESTRNGPLITIPSPRLSSHPSHLTHSQHPQQQPHHHHAPESILPSNPPPTSNPPQATGSTTAGSGAKPAFETRNPRSPYRSFSIKHIDDTRTTYLALLSADGGLTVYENDRVENLAAFSLMDEFNVLDPTAATGPGQASTAPRGQETSFRVRFDPNPDVCYTALRDGVLSDALGLVVAVQDTVKVYRTRDAVRASLGLAAATKEFYLAAEVVAGVHRGLVRDVAWAPGNIRGYDIIATACQDGFVRVFRLDTLSPSTSDTTKFAREPSSIDLTQGGELDDEKRAQESAPESRWSSSRVRRHATRRQGPSQDALTITTSGLRASLDSHNHQQTPSRELDAADRRSRRAWTNQPGQVRHTLTEISRLDNHRTPVWRVAFDDDGQILGSVGDEGKLLCYRQKPDGTWAKSSEMSVVKVKMAAPQ

SEH1

Nucleoporin SEH1

349 amino acids

Functions as a component of the nuclear pore complex (NPC). NPC components, collectively referred to as nucleoporins (NUPs), can play the role of both NPC structural components and of docking or interaction partners for transiently associated nuclear transport factors. Involved in nuclear poly(A)+ RNA export and NPC biogenesis. It is also required for normal nuclear morphology. Component of the SEA complex which coats the vacuolar membrane and is involved in intracellular trafficking, autophagy, response to nitrogen starvation, and amino acid biogenesis.

Belongs to the WD repeat SEC13 family.

39.123 kDa

MQPFDSGHDDLVHDVVYDFYGRHVATCSSDQHIKVFKLDKDTSNWELSDSWRAHDSSIVAIDWASPEYGRIIASASYDKTVKLWEEDPDQEECSGRRWNKLCTLNDSKGSLYSVKFAPAHLGLKLACLGNDGILRLYDALEPSDLRSWTLTSEMKVLSIPPANHLQSDFCLSWCPSRFSPEKLAVSALEQAIIYQRGKDGKLHVAAKLPGHKSLIRSISWAPSIGRWYQLIATGCKDGRIRIFKITEKLSPLASEESLTNSNMFDNSADVDMDAQGRSDSNTEEKAELQSNLQVELLSEHDDHNGEVWSVSWNLTGTILSSAGDDGKVRLWKATYSNEFKCMSVITAQQ

seh1

Nucleoporin seh1

339 amino acids

Functions as a component of the nuclear pore complex (NPC). NPC components, collectively referred to as nucleoporins (NUPs), can play the role of both NPC structural components and of docking or interaction partners for transiently associated nuclear transport factors. Active directional transport is assured by both, a Phe-Gly (FG) repeat affinity gradient for these transport factors across the NPC and a transport cofactor concentration gradient across the nuclear envelope.

Belongs to the WD repeat SEC13 family.

38.565 kDa

MDDISATTIQTNHQDLVNDVTYDFYGRRMVSCSADQRVKVYDFNDDTETWAITSEWRAGDASLMRVAWAHPSFGQVLAVCSLDRGVRIYEEQKKNFESKTWVEVAKLMDARSAVLDISFCPFQHGCKLAAVSADATLRIYEAMEPGNLTYWTLMNEIALMPSPPSRNEQPAFCVNWCPSRWREQYIAVGCMNDAYIYKQNSHGKWKKVAELPGHTDLIRDICWAPSMGSSYYLIATACKDGNVRIFKVETLCEEVFQEEEDAGNSMTEDSNFNLNSLKVELIGEYDNHKCQVWRCRFNVTGTILSSSGDDGCVRLWKASYANLFKCISVVSLEKKPEKL

SEH1

Protein SEH1

326 amino acids

Required for proper export of mRNAs from the nucleus to the cytoplasm.

Belongs to the WD repeat SEC13 family.

35.696 kDa

MAKSMATLDSGTTCSSWNQSGDRLAAGSLNGKLSIYESSTSSSSTFSCTSKVRVSESSIVKIVWLPSEYGDAVACVCEDGSLSIWEELSEDAHGLEWKLCKSMKNKSSQVLDVQFGVSRKSLKMVAAYSDGYLRVFELLNPLELKNWQLQAEFQNVIDSLSTLGKPSSLSASVSWNPMKGEEQEPSFVLAFNSDSPHLNSSKIWEFDEAHNRWLAVAELALPEDKGDPVYALSWAPNIGRPYEVVAVATHKGIGIWHVGLAPDLEGRLPVKKVSSLSGHQGEVWQMEWDMSGMTLASTGSDGMVKLWQSNLNGEWHEQATLEPVPS