SEC62

Translocation protein SEC62

399 amino acids

Mediates post-translational transport of precursor polypeptides across endoplasmic reticulum (ER). Proposed to act as a targeting receptor for small presecretory proteins containing short and apolar signal peptides. Targets and properly positions newly synthesized presecretory proteins into the SEC61 channel-forming translocon complex, triggering channel opening for polypeptide translocation to the ER lumen.

Belongs to the SEC62 family.

45.862 kDa

MAERRRHKKRIQEVGEPSKEEKAVAKYLRFNCPTKSTNMMGHRVDYFIASKAVDCLLDSKWAKAKKGEEALFTTRESVVDYCNRLLKKQFFHRALKVMKMKYDKDIKKEKDKGKAESGKEEDKKSKKENIKDEKTKKEKEKKKDGEKEESKKEETPGTPKKKETKKKFKLEPHDDQVFLDGNEVYVWIYDPVHFKTFVMGLILVIAVIAATLFPLWPAEMRVGVYYLSVGAGCFVASILLLAVARCILFLIIWLITGGRHHFWFLPNLTADVGFIDSFRPLYTHEYKGPKADLKKDEKSETKKQQKSDSEEKSDSEKKEDEEGKVGPGNHGTEGSGGERHSDTDSDRREDDRSQHSSGNGNDFEMITKEELEQQTDGDCEEDEEEENDGETPKSSHEKS

SEC62

Translocation protein SEC62

399 amino acids

Mediates post-translational transport of precursor polypeptides across endoplasmic reticulum (ER). Proposed to act as a targeting receptor for small presecretory proteins containing short and apolar signal peptides. Targets and properly positions newly synthesized presecretory proteins into the SEC61 channel-forming translocon complex, triggering channel opening for polypeptide translocation to the ER lumen.

Belongs to the SEC62 family.

45.888 kDa

MAERRRHKKRIQEVGEPSKEEKAVAKYLRFNCPTKSTNMMGHRVDYFIASKAVDCLLDSKWAKAKKGEEALFTTRESVVDYCNRLLKKQFFHRALKVMKMKYDKDIKKEKDKGKAESGKEEDKKSKKENIKDEKTKKEKEKKKDGEKEDSKKEETPGTPKKKETKKKFKLEPHDDQVFLDGNEVYVWIYDPVHFKTFVMGLILVIAVIAATLFPLWPAEMRVGVYYLSVGAGCFVASILLLAVARCILFLIIWLITGGRHHFWFLPNLTADVGFIDSFRPLYTHEYKGPKADLKKDEKSETKKQQKSDSEEKSDSEKKEDEEGKVGPGNHGTEGLGGERHSDTDSDRREDDRSQHSSGNGNDFEMITKEELEQQTDGDCEEEEEEENDGETPKSSHEKS

SEC62

Translocation protein SEC62

398 amino acids

Required for preprotein translocation.

Belongs to the SEC62 family.

45.966 kDa

MAERRRHRKRIQEVGEPFKEEKAVAKYLRFNCPTKSTNMMGHRVDYFIASKAVDCLLDSKWAKAKKGEEALFTTRESVVDYCNRLLKKQFFHRALKVMKMKPDKDTKKEKEKGKAESGKEEEKKSKKESSKDEKTKKEKEKKKDGEKEECKKDETPGTPKKKETKRKFKLEPHEDQVFLDGNEVYVWIYDPVHFKTFAMGLVLVIAVIAATLFPLWPAEMRVGVYYLSVGAGCFVASILLLAVARCILFLIIWLITGGRHHFWFLPNLTADVGFIDSFRPLYTHEYKGPKADLKKEEKSESKKQQKYDSEEKSDSEKKEEEDGKTEATRNSGTEGSGGERHSDTDSDRREDDRSQHSSGNGNDFEMITKEELEQQTDEGDCEEDEDEDTESRPSHEKS

Sec62

Translocation protein SEC62

398 amino acids

Mediates post-translational transport of precursor polypeptides across endoplasmic reticulum (ER). Proposed to act as a targeting receptor for small presecretory proteins containing short and apolar signal peptides. Targets and properly positions newly synthesized presecretory proteins into the SEC61 channel-forming translocon complex, triggering channel opening for polypeptide translocation to the ER lumen.

Belongs to the SEC62 family.

45.581 kDa

MAERRRHKKRIQEVGEPSKEEKAVAKYLRFNCPTKSTNMMGHRVDYFIASKAVECLLDSKWAKAKKGEDALFTTRESVVDYCNRLLKKQFFHRALKVMKMKYDKDVKKEKDKGKSESGKEDDKKSKKESVKEEKTKKEKEKKKDGEKEDSKKEETPGTPKKKETKKKFKLEPHDDQVFLDGNEVFVWIYDPVHIKTFVMGLILVIAVIAATLFPLWPAEMRVGVYYLSVGAGCFVASILLLAIARCILFLIIWLITGGRHHFWFLPNLTADVGFIDSFRPLYTHEYKGPKADLKKDEKSETKKQQKSDSEEKSDSEKKEDEEGKGAPADHGPEGSGGERHSDTDSDRREDDRSQHSSGNGNDFEMITKEELEQQTDGDCDEEDDDKDGEVPKSAHEKS

SEC62

Translocation protein SEC62

396 amino acids

Required for preprotein translocation.

Belongs to the SEC62 family.

44.902 kDa

MTENVPQGQITMPLQQGGAREISPQALAVADYLRSHKLLKQRPGILNGKRSDFFRVKRAIRALEDPKYKQLQSKPNSKLPPINSRNEAISIFRLMPINQMALRVDKLPTQTALMMKQKPEQGVPVLQVNPQQEFGDDMYYTWFYNPVPLTTYLYGALGVAAIFAGVLFPLWPIFLRQGVWYLSVGMLGLIGVFFGIALVRLVIFVLTWPTVKPGIWIFPNLFADVGFVDSFIPLWAWHGTPERDLLPQKFKNKKKKKNAGTVIESKEPPRKLTKEEKQKQKEANAQMEQMQAAFQTQLSSFATQMQQIKEMSDSGIDPQIIAAQLQAQYPPDKQAAIKLENEQAQAKLDERIRELAAQIQDKTNANKTGDKIEEVADKENKEAPKRIVTLEDANDE

SEC62

Translocation protein SEC62

293 amino acids

Required for preprotein translocation.

Belongs to the SEC62 family.

33.286 kDa

MSAPTPPQTGQFQVATSAQRSPVAVNIVNYLFQNPILKQRTGLLDNTNDIEFFRFKRLQRALLSDDYKQKQQNPKNGLIPVANNEDVQKVFVLLIQNQLLLPLQKLHYAEVKAVKGWKPNKEKPTLKRADKAVMDPDVYYGWLYQKPNPYILLYSFLAIAGVFAVILFPLWPNFMKRGVWYLSMGALGLIALFFATAIVRLIIYIISLVAFPKPFWLFPNLFEDCGVIESFQPVYAWEEPKKKKGKKKKEPKLEVVEEKVGSSSGDVKVTGSELSNGSSTTGKRKVTLEEVEE

SEC62

Translocation protein SEC62

278 amino acids

Required for preprotein translocation.

Belongs to the SEC62 family.

31.683 kDa

MAEVPITTSNQRSQVAINIANYLKDNKILKQRTGLLNNSEDVEFFRYKRLARALLSDDYKTKQANHKNGLIPIADEQEAAKVFITLIQSQFVIPVEKLHYNEIKQANKSWKPNKTKPTLKQSTKANIEPNAYFVWTYNKPNPFILLYSILLLVGIFTIILFPLWPNFMKIGVWYLSMGLLGLLGLFFLIAIIRLIIYIITLLVLPRAFWLYPNLFEDCGVLESFQPLYGWDEPKKSKKGKSSKSASKPETESSGAATGVKPAENAPTKRKVVLEEVDE

SEC62

Translocation protein SEC62

274 amino acids

Acts as component of the Sec62/63 complex which is involved in SRP-independent post-translational translocation across the endoplasmic reticulum (ER) and functions together with the Sec61 complex and KAR2 in a channel-forming translocon complex. In an initial step, the signal sequence seems to bind simultaneously to SEC61 and SEC62. SEC62 and SEC63 are required for interactions between SEC61 and translocating polypeptides. SEC62 may affect SEC1-polypeptide interactions by increasing the affinity of targeting pathways for SEC61 and/or by modifying SEC61 to allow more efficient polypeptide interaction. A cycle of assembly and disassembly of Sec62/63 complex from SEC61 may govern the activity of the translocon. SEC62 is essential for cell growth.

Belongs to the SEC62 family.

31.347 kDa

MSAVGPGSNAGASVNGGSATAIATLLRNHKELKQRQGLFQAKQTDFFRYKRFVRALHSEEYANKSARQPEIYPTIPSNKIEDQLKSREIFIQLIKAQMVIPVKKLHSQECKEHGLKPSKDFPHLIVSNKAQLEADEYFVWNYNPRTYMDYLIVIGVVSIILALVCYPLWPRSMRRGSYYVSLGAFGILAGFFAVAILRLILYVLSLIVYKDVGGFWIFPNLFEDCGVLESFKPLYGFGEKDTYSYKKKLKRMKKKQAKRESNKKKAINEKAEQN

sec62

Translocation protein sec62

273 amino acids

Acts as component of the Sec62/63 complex which is involved in SRP-independent post-translational translocation across the endoplasmic reticulum (ER) and functions together with the Sec61 complex and bip1 in a channel-forming translocon complex. In an initial step, the signal sequence seems to bind simultaneously to sec61 and sec62. sec62 and sec63 are required for interactions between sec61 and translocating polypeptides. sec62 may affect sec61-polypeptide interactions by increasing the affinity of targeting pathways for sec61 and/or by modifying sec61 to allow more efficient polypeptide interaction. A cycle of assembly and disassembly of Sec62/63 complex from sec61 may govern the activity of the translocon (By similarity).

Belongs to the SEC62 family.

31.586 kDa

MDSSNVPVLKDEDKCKFSMRFTNFLKSRPELKTKPAILNGKRVYYFRVKRVLRFLTSEAYTPKKYKGFPEISSREEAIEVLKLLIMNSMLVRVDKLPPKQRKQKLVELQINRNQDFQDDMHYVWLYEPLPKRVMALAVLFALVVLALVLFPLWPMFMRKGAWYLSMGGLGVIGLFFVLVILRFFLFCITAVIVRPGIWLFPNLLADVGFCDSFKPLWSWHNSKSEVKKTRKSKKLSKKATSPAASATPEKSSTSTTSLKNLRHRNPTVEEVSE

SEC62

Translocation protein SEC62

257 amino acids

Required for preprotein translocation.

Belongs to the SEC62 family.

30.095 kDa

MDQSAVLAIASFVRNRSELKARKGLFQDKPTDFFRYKRFVRCLKSDAYKKKSLKQPDLYPPLPEDEEKFAELARGIFVEFIKNQLVVPGQKLHSYECKEHGLKPSKDYPHLIMSTKATLDDNEYYLWHYNPKTLTDYLIVFGVIGVILAFVCYPLWPASMRRGTYYLSLAAFGFLGVFFGVAIIRLIVFLISMLFIREKGGFWLFPNLFEDCGFFDSFKPLYGFGDKETYTYIKKMKKQKKRQAKKEKLKKLKEKAN

SEC62

Translocation protein SEC62

246 amino acids

Required for preprotein translocation.

Belongs to the SEC62 family.

28.172 kDa

MSEPSPQSTIAIANLLRTHSDLKQRQGLFQSRLVDFFRYKRFVRALKSDKYKAKSKKQPELYPAVTSDEDARNIFVSLIKAQFVVPAVKLHSAECKEHGLKPNKSYPNLLLSNKATLQPDEYYVWSYNPKSIYDYLTVIGIIVGVLAFVCYPLWPPYMKRGTYYLSIAALALIGVFFGIAIVRLIVYLLSLAAVSEKGGFWLFPNLFEDCGVIESFKPLYGFGEKECYSFLKKEKRKHRSVAKKQK

SEC62

Translocation protein SEC62

244 amino acids

Required for preprotein translocation.

Belongs to the SEC62 family.

28.406 kDa

MSDPESPLWVATLLRHHKELKQRQGMFQSRHMEFFRFKRFVRALNSDEYRAKSEREPEKYPPVRSEEDARDVFVSLIKAQLVLPCTKLHTAQCREHGLAPSKDYPHLLLSTKATLDADEYYVWTHNPKTLTDYLTVVGVIVGILAFVCYPLWPHSMKRVVYYLSLGLLGLLAVFSALALVRFVIYVLSLAFCSERGGFWIFPNLFEDCGVIASFKPLYGFGETECYGYIKKQKRRKRKLEKKKQ

SEC62

Translocation protein SEC62

39 amino acids

Mediates post-translational transport of precursor polypeptides across endoplasmic reticulum (ER). Proposed to act as a targeting receptor for small presecretory proteins containing short and apolar signal peptides. Targets and properly positions newly synthesized presecretory proteins into the SEC61 channel-forming translocon complex, triggering channel opening for polypeptide translocation to the ER lumen.

Belongs to the SEC62 family.

4.498 kDa

multiple

MGHRVDYFIASKAVDXLLMKYDKDIKKEKEKGKAESGKE