SDHAF3

Succinate dehydrogenase assembly factor 3, mitochondrial

125 amino acids

Plays an essential role in the assembly of succinate dehydrogenase (SDH), an enzyme complex (also referred to as respiratory complex II) that is a component of both the tricarboxylic acid (TCA) cycle and the mitochondrial electron transport chain, and which couples the oxidation of succinate to fumarate with the reduction of ubiquinone (coenzyme Q) to ubiquinol. Promotes maturation of the iron-sulfur protein subunit SDHB of the SDH catalytic dimer, protecting it from the deleterious effects of oxidants. May act together with SDHAF1.

Belongs to the complex I LYR family. SDHAF3 subfamily.

14.754 kDa

MSALHVSRVRALYRRILLLHRVLPPDLKDLGDRYVKDEFRRHKTAGSKEAERFLQEWEAYAAVLWQQANESRQNSTEKACFGISLPEEKLNDFRDEQIGQLQELMQEATKPNRQFNITESRKPKL

SDHAF3

Succinate dehydrogenase assembly factor 3, mitochondrial

125 amino acids

Plays an essential role in the assembly of succinate dehydrogenase (SDH), an enzyme complex (also referred to as respiratory complex II) that is a component of both the tricarboxylic acid (TCA) cycle and the mitochondrial electron transport chain, and which couples the oxidation of succinate to fumarate with the reduction of ubiquinone (coenzyme Q) to ubiquinol. Promotes maturation of the iron-sulfur protein subunit SDHB of the SDH catalytic dimer, protecting it from the deleterious effects of oxidants. May act together with SDHAF1.

Belongs to the complex I LYR family. SDHAF3 subfamily.

14.652 kDa

MPGRHVSRVRALYKRVLQLHRVLPPDLKSLGDQYVKDEFRRHKTVGSDEAQRFLQEWEVYATALLQQANENRQNSTGKACFGTFLPEEKLNDFRDEQIGQLQELMQEATKPNRQFSISESMKPKF

Sdhaf3

Succinate dehydrogenase assembly factor 3, mitochondrial

125 amino acids

Plays an essential role in the assembly of succinate dehydrogenase (SDH), an enzyme complex (also referred to as respiratory complex II) that is a component of both the tricarboxylic acid (TCA) cycle and the mitochondrial electron transport chain, and which couples the oxidation of succinate to fumarate with the reduction of ubiquinone (coenzyme Q) to ubiquinol. Promotes maturation of the iron-sulfur protein subunit Sdhb of the SDH catalytic dimer, protecting it from the deleterious effects of oxidants. May act together with SDHAF1.

Belongs to the complex I LYR family. SDHAF3 subfamily.

14.468 kDa

MPGKHVSRVRALYRRILLLHRALPPDLKALGDQYVKDEFRRHKTVGPGEAQRFLKEWETYAAVLWQQAEDSRQSSTGKACFGTSLPEEKLNDFRDEQIGQLQELMQEATKPNRQFSITESTKPQL

Sdhaf3

Succinate dehydrogenase assembly factor 3, mitochondrial

125 amino acids

Plays an essential role in the assembly of succinate dehydrogenase (SDH), an enzyme complex (also referred to as respiratory complex II) that is a component of both the tricarboxylic acid (TCA) cycle and the mitochondrial electron transport chain, and which couples the oxidation of succinate to fumarate with the reduction of ubiquinone (coenzyme Q) to ubiquinol. Promotes maturation of the iron-sulfur protein subunit Sdhb of the SDH catalytic dimer, protecting it from the deleterious effects of oxidants. May act together with SDHAF1.

Belongs to the complex I LYR family. SDHAF3 subfamily.

14.525 kDa

MTGRHVSRVRSLYRRILQLHRALPPDLKALGDQYVKDEFRRHKTVGPGEAQRFLKEWETYAAVLWQQAKDSRQSSSGKACFGTSLPEEKLNDFRDEQIGQLQELMQEATKPNRQFSITESTKPHL

sdhaf3

Succinate dehydrogenase assembly factor 3, mitochondrial

123 amino acids

Plays an essential role in the assembly of succinate dehydrogenase (SDH), an enzyme complex (also referred to as respiratory complex II) that is a component of both the tricarboxylic acid (TCA) cycle and the mitochondrial electron transport chain, and which couples the oxidation of succinate to fumarate with the reduction of ubiquinone (coenzyme Q) to ubiquinol. Promotes maturation of the iron-sulfur protein subunit sdhb of the SDH catalytic dimer, protecting it from the deleterious effects of oxidants. May act together with SDHAF1.

Belongs to the complex I LYR family. SDHAF3 subfamily.

14.449 kDa

MANPAHISAVRTLYKKILVLHRFLPIDLRALGDQYVKDEFRRHKTSSDEEAKHFMVEWQNYKDTLQTQVLEAMGNKKLVFGADLSEDKLKHFQDEQIGQLYELMLESTKPNRQFDIQEEGTPK

Sdhaf3

Succinate dehydrogenase assembly factor 3, mitochondrial

120 amino acids

Plays an essential role in the assembly of succinate dehydrogenase (SDH), an enzyme complex (also referred to as respiratory complex II) that is a component of both the tricarboxylic acid (TCA) cycle and the mitochondrial electron transport chain, and which couples the oxidation of succinate to fumarate with the reduction of ubiquinone (coenzyme Q) to ubiquinol. Promotes maturation of the iron-sulfur protein subunit SdhB of the SDH catalytic dimer, protecting it from the deleterious effects of oxidants.

Belongs to the complex I LYR family. SDHAF3 subfamily.

13.894 kDa

MSRILMSQLTHPQRVRLLYKTILRLHRGLPAELRALGDNYVRDEFRRHLKCNPMEAQLFMTEWARYASTITQQLGIRGKPKGELGEEIDPKTVEMLKDDQVVQLYELMLAAKGVEDAQGK