Protein
Succinate dehydrogenase assembly factor 2, mitochondrial
Organism
Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Function
Plays an essential role in the assembly of succinate dehydrogenase (SDH), an enzyme complex (also referred to as respiratory complex II) that is a component of both the tricarboxylic acid (TCA) cycle and the mitochondrial electron transport chain, and which couples the oxidation of succinate to fumarate with the reduction of ubiquinone (coenzyme Q) to ubiquinol. Required for flavinylation (covalent attachment of FAD) of the flavoprotein subunit SDH1 of the SDH catalytic dimer. It is unclear whether it participates in the chemistry of FAD attachment (enzymatic function) or acts as a chaperone that maintains SDH1 in a conformation that is susceptible to autocatalytic FAD attachment (PubMed:19628817). Does not bind FAD or FADH(2) in vitro (PubMed:23062074). Involved in sporulation (PubMed:12432101). Required for the full activation of the early meiotic inducer IME1 (PubMed:12586695).
Similarity
Belongs to the SDHAF2 family.
Sequence
MHNMFPALTKTLSLQGYKIINSQTGSAAWSCGRRWFSSDKDDHDDVVTRIKIAPIKRTNEPLDKKRARLIYQSRKRGILETDLLLSGFAAKYLKKMNEEELEEYDSLLNELDWDIYYWATKNFKTSPLPDKWANSKLLKQLQEFSENKEKEILSMPDLSKYQ