SDH2

Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial

297 amino acids

Iron-sulfur protein (IP) subunit of succinate dehydrogenase (SDH) that is involved in complex II of the mitochondrial electron transport chain and is responsible for transferring electrons from succinate to ubiquinone (coenzyme Q).

Belongs to the succinate dehydrogenase/fumarate reductase iron-sulfur protein family.

33.667 kDa

MALRLATRRFAPIAFRRGMATTIEHTKEPISATAEALSASRPPIKETKTSTVKEPQMDADAKTKTFHIYRWNPDQPTDKPRMQSYTLDLNKTGPMMLDALIRIKNEVDPTLTFRRSCREGICGSCAMNIDGVNTLACLCRIPTDTAKETRIYPLPHTYVVKDLVPDMTQFYKQYKSIKPYLQRDTAPPDGKENRQSVADRKKLDGLYECILCACCSTSCPSYWWNSEEYLGPAVLLQSYRWINDSRDEKTAQRKDALNNSMSLYRCHTILNCSRTCPKGLNPALAIAEIKKSMAFTG

SDH2

Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial

295 amino acids

Iron-sulfur protein (IP) subunit of succinate dehydrogenase (SDH) that is involved in complex II of the mitochondrial electron transport chain and is responsible for transferring electrons from succinate to ubiquinone (coenzyme Q).

Belongs to the succinate dehydrogenase/fumarate reductase iron-sulfur protein family.

33.282 kDa

MSLFNVSNGLRTALRPSVASSSRVAAFSTTAAARLATPTSDNVGSSGKPQHLKQFKIYRWNPDKPSEKPRLQSYTLDLNQTGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGVNTLACLCRIDKQNDTKIYPLPHMYIVKDLVPDLTQFYKQYRSIEPFLKSNNTPSEGEHLQSPEERRRLDGLYECILCACCSTSCPSYWWNQDEYLGPAVLMQAYRWMADSRDDFGEERRQKLENTFSLYRCHTIMNCSRTCPKNLNPGKAIAQIKKDMAVGAPKASERPIMASS

SDH2

Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial

283 amino acids

Iron-sulfur protein (IP) subunit of succinate dehydrogenase (SDH) that is involved in complex II of the mitochondrial electron transport chain and is responsible for transferring electrons from succinate to ubiquinone (coenzyme Q).

Belongs to the succinate dehydrogenase/fumarate reductase iron-sulfur protein family.

32.104 kDa

MINIPNSIRPFIRSANRTPCYLRSISSSSSSSFATPAEEHAGKQPSSAVPVKEFSIYRWNPDEPSKKPTLQTYSIDLKKCGPMVLDALIKIKNELDPTLTFRRSCREGICGSCAMNIDGVNTLACLKRINKETSAPVKIYPLPHMYIIKDLVPDMTHFYKQYKSIEPFLKNDNPPAQGEFLQSPEDRKKLDGMYECILCACCSTSCPSYWWNQDEYLGPAVLMQAYRWMADSRDSYGEDRKEKLQNTLSLYRCHTIFNCTKTCPKGLNPAKAISHIKREMASA

sdh2

Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial

275 amino acids

Iron-sulfur protein (IP) subunit of succinate dehydrogenase (SDH) that is involved in complex II of the mitochondrial electron transport chain and is responsible for transferring electrons from succinate to ubiquinone (coenzyme Q).

Belongs to the succinate dehydrogenase/fumarate reductase iron-sulfur protein family.

31.426 kDa

MFSRRIQVLSPFLKHFVNRNARMMATEANISATSANPQSQGENLKTFEIYRWNPEKPEVKPKLQKYTVDLTKCGPMVLDALIKIKNEQDPTLTFRRSCREGICGSCAMNINGSNTLACICNIKKDNKPTKIYPLPHCFIVKDLVPDLTYFYKQYKSIEPWLQNDNIPKDKEFYQSRADRAKLDGLYECILCACCSTSCPSYWWNSEEYLGPAVLMQAYRWIIDSRDQATAKRLDVMQNSMSVYRCHTIMNCARTCPKGLNPGLAIAKVKALMATA

SDH2

Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial

266 amino acids

Subunit of succinate dehydrogenase (SDH) that is involved in complex II of the mitochondrial electron transport chain and is responsible for transferring electrons from succinate to ubiquinone (coenzyme Q). SDH1 and SDH2 form the catalytic dimer. Electrons flow from succinate to the FAD bound to SDH1, and sequentially through the iron-sulfur clusters bound to SDH2 and enter the membrane dimer formed by SDH3 and SDH4.

Belongs to the succinate dehydrogenase/fumarate reductase iron-sulfur protein family.

30.231 kDa

MLNVLLRRKAFCLVTKKGMATATTAAATHTPRLKTFKVYRWNPDEPSAKPHLQSYQVDLNDCGPMVLDALLKIKDEQDSTLTFRRSCREGICGSCAMNIGGRNTLACICKIDQNESKQLKIYPLPHMFIVKDLVPDLTNFYQQYKSIQPYLQRSSFPKDGTEVLQSIEDRKKLDGLYECILCACCSTSCPSYWWNQEQYLGPAVLMQAYRWLIDSRDQATKTRKAMLNNSMSLYRCHTIMNCTRTCPKGLNPGLAIAEIKKSLAFA

SDH2

Succinate dehydrogenase [ubiquinone] iron-sulfur subunit

262 amino acids

Iron-sulfur protein (IP) subunit of succinate dehydrogenase (SDH) that is involved in complex II of the mitochondrial electron transport chain and is responsible for transferring electrons from succinate to ubiquinone (coenzyme Q).

Belongs to the succinate dehydrogenase/fumarate reductase iron-sulfur protein family.

30.268 kDa

MNLFSLKAEKFLNLKTLSDLKLIKIFRWDSSEKKDPWYSTYVVSLKNCGPIVLDALIKIKNECDSTVSFRRSCREGICGSCAININGTNSLACLQKLNIKNNIIYVYPLPHIFVLKDLVVDLTNFYAQYRLIQPWLQSSLNIKSKKEIYQSKQDRLYLDGLYECILCACCSASCPSYWWNHDKYLGPAVLLQAYRWIVDSRDDNTLSRLLSLKDSYKLYRCHTIMNCTKTCPKHLNPGKVIASIKKRLLNLEVLGEKRDLNS

SDH2

Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial

261 amino acids

Iron-sulfur protein (IP) subunit of succinate dehydrogenase (SDH) that is involved in complex II of the mitochondrial electron transport chain and is responsible for transferring electrons from succinate to ubiquinone (coenzyme Q).

Belongs to the succinate dehydrogenase/fumarate reductase iron-sulfur protein family.

29.436 kDa

MVFRAGIGRIGLIRGLATQAAEVSATRYKSFKIYRWNPDTPAEKPRMQEYKVDLNKCGPMVLDALIKIKNEQDPTLTFRRSCREGICGSCAMNIGGRNTLACLCKIDQAENKDVKIYPLPHMYVVKDLVPDLTNFYKQYKSIQPYLQKASKPADGREHLQSIADRKKLDGLYECILCACCSTACPSYWWNNEQYLGPAVLMQAYRWMVDSRDGAGAGRREQLQNAMSVYRCHTIMNCTRTCPKGLNPGKAIAEIKKALAFA

SDH2

Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial

253 amino acids

Iron-sulfur protein (IP) subunit of succinate dehydrogenase (SDH) that is involved in complex II of the mitochondrial electron transport chain and is responsible for transferring electrons from succinate to ubiquinone (coenzyme Q).

Belongs to the succinate dehydrogenase/fumarate reductase iron-sulfur protein family.

29.054 kDa

MFMLRVSRRGLATATSVPRLKTFKIYRWNPDKPTEKPHLQEYKVDLEDCGPMVLDALLKIKNEQDATLTFRRSCREGICGSCAMNIGGANTLACLCKIDQDESKTTKIYPLPHMFIVKDLVPDLTGFYQQYKSIQPYLQRTDYPADGKEVLQSIDDRKKLDGLYECILCACCSTSCPSYWWNQEEYLGPAVLMQAYRWLIDSRDQATKARRTMLQNSMSLYRCHTIMNCTRTCPKGLNPGRSIAEIKKQLAFD

SDH2

Succinate dehydrogenase [ubiquinone] iron-sulfur subunit

250 amino acids

Iron-sulfur protein (IP) subunit of succinate dehydrogenase (SDH) that is involved in complex II of the mitochondrial electron transport chain and is responsible for transferring electrons from succinate to ubiquinone (coenzyme Q).

Belongs to the succinate dehydrogenase/fumarate reductase iron-sulfur protein family.

28.887 kDa

MIIKNLNQKIITIDNSSPYQKFIRIYRWNPNLNLNPWFSIFPISTNNCGPMILDALIQIKNIQDSSLTFRRSCREGICGSCSMNIDGTNSLACLRSLNTKSNFITIYPLPHTYIIKDLVPDLSNFYAQYKLIKPWLINKIGFSLKENLQSKIDRLELDGLYECILCACCSASCPSYWWNQDKYLGPAILLQAYRWIVDSRDNSTENRLNFLNNKMRLFRCHTIMNCSKTCPKSLNPGKAIASIKYRIINN

SDH2

Succinate dehydrogenase [ubiquinone] iron-sulfur subunit

239 amino acids

Iron-sulfur protein (IP) subunit of succinate dehydrogenase (SDH) that is involved in complex II of the mitochondrial electron transport chain and is responsible for transferring electrons from succinate to ubiquinone (coenzyme Q).

Belongs to the succinate dehydrogenase/fumarate reductase iron-sulfur protein family.

27.301 kDa

MRPRNNNLNLKFIRIYRWTPSNQAEAKFSVHPIHTSNCGPMILDALIKIKDEQDSSLAFRRSCREGICGSCSMNIDGINTLACLKPIKTNANIITIYPLPHMYIIKDLVPDLSNFFSQYKYIKPWLINNVPKKSEYLQSEKDRSELNGIYECILCACCSASCPSYWWNHDKYLGPAILLQAYRWLADSRDTNAKERLKLLGGKSKLFKCHTIMNCSRTCPKSLNPGKAIASIKHSINYS

SDH2

Succinate dehydrogenase [ubiquinone] iron-sulfur subunit

239 amino acids

Iron-sulfur protein (IP) subunit of succinate dehydrogenase (SDH) that is involved in complex II of the mitochondrial electron transport chain and is responsible for transferring electrons from succinate to ubiquinone (coenzyme Q).

Belongs to the succinate dehydrogenase/fumarate reductase iron-sulfur protein family.

27.828 kDa

MNTKKEKIMLFKVYRWNPDKKEKPHISTYSVDLNSCGPMVLDALIKIKNEQDSTLTFRRSCREGVCGSCAMNIDGTNTLACIKSIDTNKKEMKIYPLPHMHIIKDLVPDLSNFYAQYKSIEPWMKTTEKKLDKEFYQSRNDREKLDGLYECVLCACCSTSCPSYWWNSDKYLGPAVLLQAYRWIVDSRDQGTRERLQYLEDPFKLYRCHTILNCTKTCPKHLNPAQAIAKIKQNITLLT