Sctr

Secretin receptor

449 amino acids

Receptor for secretin (SCT), which is involved in different processes such as regulation of the pH of the duodenal content, food intake and water homeostasis (PubMed:25332973, PubMed:12403838). The activity of this receptor is mediated by G proteins which activate adenylyl cyclase (PubMed:9506976, PubMed:12403838). Upon binding to secretin, regulates the pH of the duodenum by (1) inhibiting the secretion of gastric acid from the parietal cells of the stomach and (2) stimulating the production of bicarbonate (NaHCO(3)) from the ductal cells of the pancreas (By similarity). In addition to regulating the pH of the duodenal content, plays a central role in diet induced thermogenesis: acts as a non-sympathetic brown fat (BAT) activator mediating prandial thermogenesis, which consequentially induces satiation. Mechanistically, secretin released by the gut after a meal binds to secretin receptor (SCTR) in brown adipocytes, activating brown fat thermogenesis by stimulating lipolysis, which is sensed in the brain and promotes satiation. Also able to stimulate lipolysis in white adipocytes. Also plays an important role in cellular osmoregulation by regulating renal water reabsorption. Also plays a role in the central nervous system: required for synaptic plasticity (By similarity).

Belongs to the G-protein coupled receptor 2 family.

51.234 kDa

MLSTMRPRLSLLLLRLLLLTKAAHTVGVPPRLCDVRRVLLEERAHCLQQLSKEKKGALGPETASGCEGLWDNMSCWPSSAPARTVEVQCPKFLLMLSNKNGSLFRNCTQDGWSETFPRPDLACGVNINNSFNERRHAYLLKLKVMYTVGYSSSLAMLLVALSILCSFRRLHCTRNYIHMHLFVSFILRALSNFIKDAVLFSSDDVTYCDAHKVGCKLVMIFFQYCIMANYAWLLVEGLYLHTLLAISFFSERKYLQAFVLLGWGSPAIFVALWAITRHFLENTGCWDINANASVWWVIRGPVILSILINFIFFINILRILMRKLRTQETRGSETNHYKRLAKSTLLLIPLFGIHYIVFAFSPEDAMEVQLFFELALGSFQGLVVAVLYCFLNGEVQLEVQKKWRQWHLQEFPLRPVAFNNSFSNATNGPTHSTKASTEQSRSIPRASII

Sctr

Secretin receptor

447 amino acids

Receptor for secretin (SCT), which is involved in different processes such as regulation of the pH of the duodenal content, food intake and water homeostasis (PubMed:20927047, PubMed:24273196, PubMed:30449620). The activity of this receptor is mediated by G proteins which activate adenylyl cyclase (PubMed:30449620). Upon binding to secretin, regulates the pH of the duodenum by (1) inhibiting the secretion of gastric acid from the parietal cells of the stomach and (2) stimulating the production of bicarbonate (NaHCO(3)) from the ductal cells of the pancreas (By similarity). In addition to regulating the pH of the duodenal content, plays a central role in diet induced thermogenesis: acts as a non-sympathetic brown fat (BAT) activator mediating prandial thermogenesis, which consequentially induces satiation (PubMed:30449620). Mechanistically, secretin released by the gut after a meal binds to secretin receptor (SCTR) in brown adipocytes, activating brown fat thermogenesis by stimulating lipolysis, which is sensed in the brain and promotes satiation (PubMed:30449620). Also able to stimulate lipolysis in white adipocytes (PubMed:24273196). Also plays an important role in cellular osmoregulation by regulating renal water reabsorption (PubMed:17283064). Also plays a role in the central nervous system: required for synaptic plasticity (PubMed:17008357).

Belongs to the G-protein coupled receptor 2 family.

50.932 kDa

MLSTMSPRLSLLLLWLLLLINAAHPVGALPRLCDVRRVLLEERAECLRELSEEKKALGPKTASGCERFWDNMSCWPSSALAQTVEVPCPKFLRMFSGRNGSLFRNCTKDGWSETFPRPDLACGVNMNGSFNERRHAYLLKLKVMYTVGYSSSLAMLLVALSILCSFRRLHCTRNYIHMHLFVSFILRALSNFIKDAVLFPADDVTYCDAHRAGCKLVMIFFQYCIMANYAWLLVEGLYLHTLLAISFFSERKCLQAFVLFGWGSPAIFVALWAVTRHFLEDFGCWDINSNASIWWVIRGPVILSIVINFIFFINILRILMRKLRTQETRGNETHHYKRLAKSTLLLIPLFGIHYIVFAFSPEGAMEVQLFFELALGSFQGLVVAVLYCFLNGELEVQKKWRQWHLQEFPLRPVALSNSFSNATNGPTHSTKAGTSEQSRSIPGANVI

SCTR

Secretin receptor

445 amino acids

Receptor for secretin (SCT), which is involved in different processes such as regulation of the pH of the duodenal content, food intake and water homeostasis. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase (By similarity). Upon binding to secretin, regulates the pH of the duodenum by (1) inhibiting the secretion of gastric acid from the parietal cells of the stomach and (2) stimulating the production of bicarbonate (NaHCO(3)) from the ductal cells of the pancreas (By similarity). In addition to regulating the pH of the duodenal content, plays a central role in diet induced thermogenesis: acts as a non-sympathetic brown fat (BAT) activator mediating prandial thermogenesis, which consequentially induces satiation. Mechanistically, secretin released by the gut after a meal binds to secretin receptor (SCTR) in brown adipocytes, activating brown fat thermogenesis by stimulating lipolysis, which is sensed in the brain and promotes satiation. Also able to stimulate lipolysis in white adipocytes. Also plays an important role in cellular osmoregulation by regulating renal water reabsorption. Also plays a role in the central nervous system: required for synaptic plasticity (By similarity).

Belongs to the G-protein coupled receptor 2 family.

50.495 kDa

MCPRPGPPLGLWLLLGFACAAHLVGAPPRLCDVLWVLQEERDQCLQELERERLGEEQPVPGCQGLWDNVSCWPSSAPGRMVELECPRFLRMLTNSNGSLFRNCTQDGWTETFPRPDLACGVSMNDSSHERQHAYLLKLKVMYTVGYSSSLVMLLVALGILCAFRRLHCTRNYIHMHLFLSFILRALSNFIKDAVLFSSDDAIHCDAHRVGCKLVMVFFQYCIMANYAWLLVEGLYLHSLLVVSFFSERKCLQGFVVLGWGSPAMFVTSWAVTRHFLEDSGCWDINANAAIWWVIRGPVILSILINFILFINILRILTRKLRTQETRGQDMNHYKRLARSTLLLIPLFGVHYIVFVFSPEGAMEIQLFFELALGSFQGLVVAVLYCFLNGEVQLEVQKKWQQWHLWEPPLCPVALSSSFSNGTSSLNSTKACPSGRSRDTCKVSII

SCTR

Secretin receptor

440 amino acids

Receptor for secretin (SCT), which is involved in different processes such as regulation of the pH of the duodenal content, food intake and water homeostasis (PubMed:7612008, PubMed:25332973). The activity of this receptor is mediated by G proteins which activate adenylyl cyclase (By similarity). Upon binding to secretin, regulates the pH of the duodenum by (1) inhibiting the secretion of gastric acid from the parietal cells of the stomach and (2) stimulating the production of bicarbonate (NaHCO(3)) from the ductal cells of the pancreas (By similarity). In addition to regulating the pH of the duodenal content, plays a central role in diet induced thermogenesis: acts as a non-sympathetic brown fat (BAT) activator mediating prandial thermogenesis, which consequentially induces satiation. Mechanistically, secretin released by the gut after a meal binds to secretin receptor (SCTR) in brown adipocytes, activating brown fat thermogenesis by stimulating lipolysis, which is sensed in the brain and promotes satiation. Also able to stimulate lipolysis in white adipocytes. Also plays an important role in cellular osmoregulation by regulating renal water reabsorption. Also plays a role in the central nervous system: required for synaptic plasticity (By similarity).

Belongs to the G-protein coupled receptor 2 family.

50.207 kDa

MRPHLSPPLQQLLLPVLLACAAHSTGALPRLCDVLQVLWEEQDQCLQELSREQTGDLGTEQPVPGCEGMWDNISCWPSSVPGRMVEVECPRFLRMLTSRNGSLFRNCTQDGWSETFPRPNLACGVNVNDSSNEKRHSYLLKLKVMYTVGYSSSLVMLLVALGILCAFRRLHCTRNYIHMHLFVSFILRALSNFIKDAVLFSSDDVTYCDAHRAGCKLVMVLFQYCIMANYSWLLVEGLYLHTLLAISFFSERKYLQGFVAFGWGSPAIFVALWAIARHFLEDVGCWDINANASIWWIIRGPVILSILINFILFINILRILMRKLRTQETRGNEVSHYKRLARSTLLLIPLFGIHYIVFAFSPEDAMEIQLFFELALGSFQGLVVAVLYCFLNGEVQLEVQKKWQQWHLREFPLHPVASFSNSTKASHLEQSQGTCRTSII