SCO2

Protein SCO2, mitochondrial

301 amino acids

Acts as a copper chaperone, transporting copper to the Cu(A) site on the cytochrome c oxidase subunit II (COX2).

Belongs to the SCO1/2 family.

34.889 kDa

MLNSSRKYACRSLFRQANVSIKGLFYNGGAYRRGFSTGCCLRSDNKESPSARQPLDRLQLGDEINEPEPIRTRFFQFSRWKATIALLLLSGGTYAYLSRKRRLLETEKEADANRAYGSVALGGPFNLTDFNGKPFTEENLKGKFSILYFGFSHCPDICPEELDRLTYWISELDDKDHIKIQPLFISCDPARDTPDVLKEYLSDFHPAIIGLTGTYDQVKSVCKKYKVYFSTPRDVKPNQDYLVDHSIFFYLIDPEGQFIDALGRNYDEQSGLEKIREQIQAYVPKEERERRSKKWYSFIFN

sco2

Protein SCO2 homolog, mitochondrial

279 amino acids

Copper metallochaperone essential for the synthesis and maturation of cytochrome c oxidase subunit II (MT-CO2/COX2). Involved in transporting copper to the Cu(A) site on MT-CO2/COX2. Also acts as a thiol-disulfide oxidoreductase to regulate the redox state of the cysteines in SCO1 during maturation of MT-CO2/COX2.

Belongs to the SCO1/2 family.

32.111 kDa

MLRLRVFDRHKRLWSVLQSTIRGNNISNHIPNTTCRSSAPPHLCARQRAFYSQNSPKTPNPGSSAGIKLRTRLVVTLLFGGGIIGTWWYVHQEKEKRIQMQRLEQLRKVALGQGDFHLLDHTGQRRTKRDFLGHWVLLYFGFTHCPDICPDELEKLTSVVHILDKDPSLPSVQPLFITVDPERDDVSAMARYVKDFHPRLVGLTGSAEEVKQAGRDFRVYASNGPKDEDGDYIVDHSIVIYLVNPDGLFIDYYNRMKNDTQIAESIRNHMKTFVRLFPD

SCO2

Protein SCO2 homolog, mitochondrial

266 amino acids

Copper metallochaperone essential for the synthesis and maturation of cytochrome c oxidase subunit II (MT-CO2/COX2). Involved in transporting copper to the Cu(A) site on MT-CO2/COX2. Also acts as a thiol-disulfide oxidoreductase to regulate the redox state of the cysteines in SCO1 during maturation of MT-CO2/COX2.

Belongs to the SCO1/2 family.

29.789 kDa

MLLLARPPKAWHRLFQLQPLALLGTPGGKTQHVRYQLFSTPGPADTGRQGQPQGPGLRTRLLVTALVGAGLGGAWLALRAEKERGRQQQRTEALRQAAVGQGDFSLLDHRGRVRCKADFRGQWVLLYFGFTHCPDICPDELEKLVQVVRQLEAEPGLPPVQPLFITVDPERDTVAAMARYVQDFHPRLLGLTGSAEQIAQVSRSYRVYYSAGPKDEDQDYIVDHSIAIYLLSPDGLFTDYYSRARSAEQITDSVRRHMAAFRSVLR

SCO2

Protein SCO2 homolog, mitochondrial

266 amino acids

Copper metallochaperone essential for the synthesis and maturation of cytochrome c oxidase subunit II (MT-CO2/COX2). Involved in transporting copper to the Cu(A) site on MT-CO2/COX2 (PubMed:15229189, PubMed:17189203). Also acts as a thiol-disulfide oxidoreductase to regulate the redox state of the cysteines in SCO1 during maturation of MT-CO2/COX2 (PubMed:19336478).

Belongs to the SCO1/2 family.

29.81 kDa

MLLLTRSPTAWHRLSQLKPRVLPGTLGGQALHLRSWLLSRQGPAETGGQGQPQGPGLRTRLLITGLFGAGLGGAWLALRAEKERLQQQKRTEALRQAAVGQGDFHLLDHRGRARCKADFRGQWVLMYFGFTHCPDICPDELEKLVQVVRQLEAEPGLPPVQPVFITVDPERDDVEAMARYVQDFHPRLLGLTGSTKQVAQASHSYRVYYNAGPKDEDQDYIVDHSIAIYLLNPDGLFTDYYGRSRSAEQISDSVRRHMAAFRSVLS

Sco2

Protein SCO2 homolog, mitochondrial

255 amino acids

Copper metallochaperone essential for the synthesis and maturation of cytochrome c oxidase subunit II (MT-CO2/COX2). Involved in transporting copper to the Cu(A) site on MT-CO2/COX2. Also acts as a thiol-disulfide oxidoreductase to regulate the redox state of the cysteines in SCO1 during maturation of MT-CO2/COX2.

Belongs to the SCO1/2 family.

28.944 kDa

MLLALGPKAWPKLSQFKPLLRISGGETLHRNSRHWAGQGQRQGPGLRTRLLITALFGAGLGWAWLAARAEKEQWRQQQRTEALRQAAVGQGDFSLLDHKGQPRCKADFRGQWVLMYFGFTHCPDICPDELEKLVQVVRKLEAEPDLPLVQPVFITVDPERDDVAAMARYVQEFHPRLLGLTGSTEQVAHASRNYRVYYSAGPKDEDQDYIVDHSIAIYLLNPDGLFTDYYGRSRSAEQIVESIRRHIAAFHSVLP

SCO2

Protein disulfide-isomerase SCO2

187 amino acids

Protein disulfide-isomerase involved in chloroplast development in cotyledons. Involved in the process of vesicle-derived thylakoid formation, probably at the level of the integration and folding of LHCB proteins at the initial location of integration. Acts only in germinating seeds after dormancy, during the transition from heterotrophic to autotrophic growth.

20.843 kDa

MFRLYPNCSLPSHRPLVFLPRLPSRSLRCRAAADIPLGDGIRLPREADSTSDTARSRDVSVAAGGNGEGAKWRKRRLLWSKSGESYLVDDGDALPLPMTYPDTSPVSPDVIDRRLQCDPVVEDCREVVYEWTGKCRSCQGSGTVSYYKKRGKEVICKCIPCQGIGYVQKITSRTDIEVMEDLDNEPS