SCO1

Protein SCO1 homolog, mitochondrial

305 amino acids

Copper metallochaperone essential for the maturation of cytochrome c oxidase subunit II (MT-CO2/COX2). Not required for the synthesis of MT-CO2/COX2 but plays a crucial role in stabilizing MT-CO2/COX2 during its subsequent maturation. Involved in transporting copper to the Cu(A) site on MT-CO2/COX2. Plays an important role in the regulation of copper homeostasis by controlling the abundance and cell membrane localization of copper transporter CTR1.

Belongs to the SCO1/2 family.

33.658 kDa

MAGLLLAPGRIMRLPGSQLWRLFPRGFGVWGPGKETASVLLGRLCARPEEAWRASGLAACCLGSRPLSTAMPPPPGSSGPEWKGSGDPMRPSKPGPVSWKSLAVTFAIGGALLAGMKYFKKEKTEKLEKERHRSIGKPLLGGPFSLTTHTGEPKTDKDYLGQWVLIYFGFTHCPDICPEELEKMIQVVDEIDSIPTLPNLTPLFITIDPERDTKEAIANYVKEFSPKLIGLTGTKEEIDQVARAFRVYYSPGPKDEDEDYIVDHTIIMYLIGPDGEFLDYFGQNKKNAEIAGSIAAHMRTHRKKS

SCO1

Protein SCO1 homolog, mitochondrial

301 amino acids

Copper metallochaperone essential for the maturation of cytochrome c oxidase subunit II (MT-CO2/COX2). Not required for the synthesis of MT-CO2/COX2 but plays a crucial role in stabilizing MT-CO2/COX2 during its subsequent maturation. Involved in transporting copper to the Cu(A) site on MT-CO2/COX2 (PubMed:15659396, PubMed:16735468, PubMed:17189203, PubMed:19336478, PubMed:15229189). Plays an important role in the regulation of copper homeostasis by controlling the abundance and cell membrane localization of copper transporter CTR1 (By similarity).

Belongs to the SCO1/2 family.

33.814 kDa

MAMLVLVPGRVMRPLGGQLWRFLPRGLEFWGPAEGTARVLLRQFCARQAEAWRASGRPGYCLGTRPLSTARPPPPWSQKGPGDSTRPSKPGPVSWKSLAITFAIGGALLAGMKHVKKEKAEKLEKERQRHIGKPLLGGPFSLTTHTGERKTDKDYLGQWLLIYFGFTHCPDVCPEELEKMIQVVDEIDSITTLPDLTPLFISIDPERDTKEAIANYVKEFSPKLVGLTGTREEVDQVARAYRVYYSPGPKDEDEDYIVDHTIIMYLIGPDGEFLDYFGQNKRKGEIAASIATHMRPYRKKS

SCO1

Protein SCO1, mitochondrial

295 amino acids

Required for the accumulation of subunits 1 and 2 of cytochrome c oxidase complex. Thought to play a role in either mitochondrial copper transport or insertion of copper into the active site of COX.

Belongs to the SCO1/2 family.

33.166 kDa

MLKLSRSANLRLVQLPAARLSGNGAKLLTQRGFFTVTRLWQSNGKKPLSRVPVGGTPIKDNGKVREGSIEFSTGKAIALFLAVGGALSYFFNREKRRLETQKEAEANRGYGKPSLGGPFHLEDMYGNEFTEKNLLGKFSIIYFGFSNCPDICPDELDKLGLWLNTLSSKYGITLQPLFITCDPARDSPAVLKEYLSDFHPSILGLTGTFDEVKNACKKYRVYFSTPPNVKPGQDYLVDHSIFFYLMDPEGQFVDALGRNYDEKTGVDKIVEHVKSYVPAEQRAKQKEAWYSFLFK

Sco1

Protein SCO1 homolog, mitochondrial

284 amino acids

Copper metallochaperone essential for the maturation of cytochrome c oxidase subunit II (MT-CO2/COX2). Not required for the synthesis of MT-CO2/COX2 but plays a crucial role in stabilizing MT-CO2/COX2 during its subsequent maturation. Involved in transporting copper to the Cu(A) site on MT-CO2/COX2 (By similarity). Plays an important role in the regulation of copper homeostasis by controlling the abundance and cell membrane localization of copper transporter CTR1 (PubMed:25683716, PubMed:28973536).

Belongs to the SCO1/2 family.

31.617 kDa

MAALVRAAVVRSQCRQLWRLFPRGHGLRDVAERPRPEEACSCLRSRAFSAGPPPPGAGPEPKGGQAGSHRPKPGPVSWKSLALTFAIGGSLLAGMKYFKKEKIEKLEKQRHRSIGKPLLGGPFSLTTHNGEPKTDKDYLGQWVLIYFGFTHCPDICPEELEKMIEVVEEIDSIPSLPNLTPLFITIDPERDTKEAIATYVKEFSPKLVGLTGTKEEIDGVARAYRVYYSPGPKDEDEDYIVDHTIIMYLIGPDGEFLDYFGQNKKKAEIAGSIAAHMRSHMKKR

sco1

Protein sco1

263 amino acids

Acts as a copper chaperone, transporting copper to the Cu(A) site on the cytochrome c oxidase subunit II (COX2).

Belongs to the SCO1/2 family.

30.24 kDa

MFRRGLVFSRHCHYSLIRPRFPLNRTCLARFADGRKNLATDNRTQTYQSWRGMISIRALLLAAATSVGLYAYFQHEKKKVLERQNDKVLATIGRPQLGGAFSLIDHHGNRVTDNDFKGKFSLIYFGFTRCPDICPDELDKMSAAIDIVNNVVGDVVYPIFITCDPARDPPQEMAEYLEDFNPKIVGLTGSYEEIKDICKKFRVYFSTPKNIDPKKDDYLVDHSVFFYLMDPEGKFIEVFGRNSTSEDLARAIGSYYLSRKKQK