About Products Protein Database Contact

SAS0768

Gene
SAS0768
Protein
Organic hydroperoxide resistance protein-like
Organism
Staphylococcus aureus (strain MSSA476)
Length
140 amino acids
Similarity
Belongs to the OsmC/Ohr family.
Mass
15.329 kDa
Sequence
MAIHYETKATNVGGRKGHVYTDDRALDIDIVSPAQADGKATNPEQLFAAGYASCFNGAFDLILKQNKVRDAHPEVTLTVRLEDDSDSESPKLSVSIDATIKNVISQEEAEKYLQMAHEFCPYSKATQGNINVDLNVNVVD