About Products Protein Database Contact

SAR2425

Gene
SAR2425
Protein
UPF0060 membrane protein SAR2425
Organism
Staphylococcus aureus (strain MRSA252)
Length
108 amino acids
Similarity
Belongs to the UPF0060 family.
Mass
11.786 kDa
Sequence
MLYPIFIFILAGLCEIGGGYLIWLWLREGQSSLVGLIGGVILMLYGVIATFQSFPSFGRVYAAYGGVFIIMSLIFAMVVDKQMPDKYDVIGAIICIVGVLVMLLPSRA