About Products Protein Database Contact

SACOL0414

Gene
SACOL0414
Protein
Efem/EfeO family lipoprotein
Organism
Staphylococcus aureus (strain COL)
Length
284 amino acids
Similarity
Belongs to the EfeM/EfeO family.
Mass
32.247 kDa
Sequence
MKKLTTLLLASTLLIAACGNDDSKKDDSKTSKKDDGVKAELKQATKAYDKYTDEQLNEFLKGTEKFVKAIENNDMAQAKALYPKVRMYYERSEPVAEAFGDLDPKIDARLADMKEEKKEKEWSGYHKIEKALYEDKKIDDVTKKDAQQLLKDAKELHAKADTLDITPKLMLQGSVDLLNEVATSKITGEEEIYSHTDLYDFKANVEGAQKIYDLFKPILEKKDKKLSDDIQMNFDKVNQLLDKYKDNNGGYESFEKVSKKDRKAFADAVNALGEPLSKMAVITE

Gene
SACOL0414
Protein
Efem/EfeO family lipoprotein
Organism
Staphylococcus aureus (strain COL)
Length
284 amino acids
Similarity
Belongs to the EfeM/EfeO family.
Mass
32.247 kDa
Sequence
MKKLTTLLLASTLLIAACGNDDSKKDDSKTSKKDDGVKAELKQATKAYDKYTDEQLNEFLKGTEKFVKAIENNDMAQAKALYPKVRMYYERSEPVAEAFGDLDPKIDARLADMKEEKKEKEWSGYHKIEKALYEDKKIDDVTKKDAQQLLKDAKELHAKADTLDITPKLMLQGSVDLLNEVATSKITGEEEIYSHTDLYDFKANVEGAQKIYDLFKPILEKKDKKLSDDIQMNFDKVNQLLDKYKDNNGGYESFEKVSKKDRKAFADAVNALGEPLSKMAVITE