About Products Protein Database Contact

SA1663

Gene
SA1663
Protein
UPF0342 protein SA1663
Organism
Staphylococcus aureus (strain N315)
Length
114 amino acids
Similarity
Belongs to the UPF0342 family.
Mass
13.31 kDa
Sequence
MAVNLYDYANQLEQALRESEEYKAIKEAFANVKANEESKKLFDEFRETQINFQQKQMQGEEIAEEDLQKAQEQAQAIEKDENISALMNAEQKMSQVFQEINQIIVKPLDEIYAD