Function
Involved in the pathway of sideretin biosynthesis from feruloyl CoA, a redox-active catecholic metabolite exuded by roots in response to iron deficiency in order to facilitate the uptake of iron; this pathway consists in the successive conversion from feruloyl CoA to scopoletin, from scopoletin to fraxetin and from fraxetin to sideretin. Catalyzes the biosynthesis of fraxetin via scopoletin hydroxylation.
Sequence
MGINFEDQTTLFNFVVREGNGVKGMIDSGLSSVPRPFVQPLSERIPTQKALTCEATQPIDLSNLDGPQHKEVAKQIVEAAETLGFFQVVNHGVSVELLELLKSSAHEFFAQAPEEKSMYLKEVSPSKLVKYGTSFVPDKEKAIEWKDYVSMLYTNDSEALQHWPQPCREVALEFLNSSMEMVKNVVNILMENVGVTLEEEKMNGLMGTKMVNMNYYPTCPSPELTVGVGRHSDMGMLTVLLQDGIGGLYVKLDNGEWAEIPPVHGALVINIGDTLQILSNGKYKSAEHRVRTTNIGSRVSVPIFTAPNPSQKVGPLPEVVKRDGVARYKEFLFQDYMNNFFGQPHDGKKSLDFARAE