s100a1

Protein S100-A1

95 amino acids

Belongs to the S-100 family.

10.672 kDa

VSQLESAMESLIKVFHTYSSKEGDKYKLSKAELKSLLQGELNDFLSASKDPMVVEKIMSDLDENQDGEVDFQEFVVLVAALTVACNEFFIESMKN

S100A1

Protein S100-A1

94 amino acids

Probably acts as a Ca(2+) signal transducer. In response to an increase in intracellular Ca(2+) levels, binds calcium which triggers a conformational change. This conformational change allows interaction of S1001A with specific target proteins, such as TPR-containing proteins, and the modulation of their activity.

Belongs to the S-100 family.

10.518 kDa

MGSELETAMETLINVFHAHSGKEGDKYKLSKKELKELLQTELSGFLDAQKDADAVDKVMKELDENGDGEVDFQEYVVLVAALTVACNNFFWENS

S100A1

Protein S100-A1

94 amino acids

Probably acts as a Ca(2+) signal transducer (PubMed:22399290). In response to an increase in intracellular Ca(2+) levels, binds calcium which triggers a conformational change (PubMed:23351007). This conformational change allows interaction of S1001A with specific target proteins, such as TPR-containing proteins, and the modulation of their activity (PubMed:22399290).

Belongs to the S-100 family.

10.546 kDa

MGSELETAMETLINVFHAHSGKEGDKYKLSKKELKELLQTELSGFLDAQKDVDAVDKVMKELDENGDGEVDFQEYVVLVAALTVACNNFFWENS

S100a1

Protein S100-A1

94 amino acids

Probably acts as a Ca(2+) signal transducer. In response to an increase in intracellular Ca(2+) levels, binds calcium which triggers a conformational change. This conformational change allows interaction of S1001A with specific target proteins, such as TPR-containing proteins, and the modulation of their activity.

Belongs to the S-100 family.

10.505 kDa

MGSELESAMETLINVFHAHSGQEGDKYKLSKKELKDLLQTELSGFLDVQKDADAVDKVMKELDENGDGEVDFKEYVVLVAALTVACNNFFWETS

S100A1

Protein S100-A1

94 amino acids

Probably acts as a Ca(2+) signal transducer. In response to an increase in intracellular Ca(2+) levels, binds calcium which triggers a conformational change. This conformational change allows interaction of S1001A with specific target proteins, such as TPR-containing proteins, and the modulation of their activity.

Belongs to the S-100 family.

10.546 kDa

MGSELETAMETLINVFHAHSGKEGDKYKLSKKELKELLQTELSGFLDAQKDVDAVDKVMKELDENGDGEVDFQEYVVLVAALTVACNNFFWENS

S100a1

Protein S100-A1

94 amino acids

Probably acts as a Ca(2+) signal transducer (By similarity). In response to an increase in intracellular Ca(2+) levels, binds calcium which triggers a conformational change (PubMed:16169012, PubMed:18650434). This conformational change allows interaction of S1001A with specific target proteins, such as TPR-containing proteins, and the modulation of their activity (By similarity).

Belongs to the S-100 family.

10.56 kDa

MGSELETAMETLINVFHAHSGKEGDKYKLSKKELKDLLQTELSSFLDVQKDADAVDKIMKELDENGDGEVDFQEFVVLVAALTVACNNFFWENS