About Products Protein Database Contact

Rsph17025_3122

Gene
Rsph17025_3122
Protein
UPF0178 protein Rsph17025_3122
Organism
Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3)
Length
161 amino acids
Similarity
Belongs to the UPF0178 family.
Mass
16.865 kDa
Sequence
MAELYIDADACPVKAEAERVAVRHGARMYLVSNGGIRPPAHPLVESVFVPEGPDAADKWIADRAGTGDVVVTSDIPLAAKAVAAGALVVKPNGETLTTANIGNALATRDLMADLRSADPFRQGGGRPFSRADRSRFLDALERAMRKAAEAARDAGQDEAGT