About Products Protein Database Contact

Rsph17025_0472

Gene
Rsph17025_0472
Protein
UPF0102 protein Rsph17025_0472
Organism
Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3)
Length
117 amino acids
Similarity
Belongs to the UPF0102 family.
Mass
12.702 kDa
Sequence
MSGEVSHRAGFVAEEAVARIYERADRPVTARRWRGAAGEIDLIARDGAEVIFIEVKKSKSHAAAAARLSRRQMERIYGAASEFLAGEPLGQLTASRFDVALVDGMGRIEIIENAFAA