About Products Protein Database Contact

Rsph17025_0068

Gene
Rsph17025_0068
Protein
Putative membrane protein insertion efficiency factor
Organism
Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3)
Length
84 amino acids
Function
Could be involved in insertion of integral membrane proteins into the membrane.
Similarity
Belongs to the UPF0161 family.
Mass
9.333 kDa
Sequence
MSPLAQIFALPVRAYRLLLSPWVGHGCRYQPTCSVYALEALERHGALKGGWLAARRILRCHPWGGSGYDPVPGADPEHDRRPRG