RTN4IP1

Reticulon-4-interacting protein 1, mitochondrial

396 amino acids

Plays a role in the regulation of retinal ganglion cell (RGC) neurite outgrowth, and hence in the development of the inner retina and optic nerve. Appears to be a potent inhibitor of regeneration following spinal cord injury.

Belongs to the zinc-containing alcohol dehydrogenase family. Quinone oxidoreductase subfamily.

43.583 kDa

MGFLKTCVFRRNACTAVCFWRSQVVQKPSVRKISTTSPRSTVMPAWVIDKYGSNEVLRFTQNMMIPMIHYPNEVIIKVHAASINPIDVNMRSGYGATALNMKRDPLHVKIKGEEFPLTLGRDVSGVVMECGLDVRYFKPGDEVWAAVPPWKQGTLSEFVVVSGNEVSHKPRSLTHTQAASLPYVALTAWSAINKVGGLNDRNCTGKRVLILGASGGVGTFAIQVMKAWDAHVTAVCSQDASELVRKLGADDVIDYKSGNVEAQLKSSKPFDFILDNVGGSTETWALKFLKKWSGATYVTLVTPFLLNMDRLGIADGMLQTGVTVGSKTLKHFWQGVHYRWAFFMASGPCLDDIAELVEAGKIQPVIEKTFPFSKVPEAFLKVERGHARGKTVINVV

RTN4IP1

Reticulon-4-interacting protein 1, mitochondrial

396 amino acids

Plays a role in the regulation of retinal ganglion cell (RGC) neurite outgrowth, and hence in the development of the inner retina and optic nerve. Appears to be a potent inhibitor of regeneration following spinal cord injury.

Belongs to the zinc-containing alcohol dehydrogenase family. Quinone oxidoreductase subfamily.

43.59 kDa

MEFLKTCVLRRNACTAVCFWRSKVVQKPSVRRISTTSPRSTVMPAWVIDKYGKNEVLRFTQNMMMPIIHYPNEVIVKVHAASVNPIDVNMRSGYGATALNMKRDPLHVKIKGEEFPLTLGRDVSGVVMECGLDVKYFKPGDEVWAAVPPWKQGTLSEFVVVSGNEVSHKPKSLTHTQAASLPYVALTAWSAINKVGGLNDKNCTGKRVLILGASGGVGTFAIQVMKAWDAHVTAVCSQDASELVRKLGADDVIDYKSGSVEEQLKSLKPFDFILDNVGGSTETWAPDFLKKWSGATYVTLVTPFLLNMDRLGIADGMLQTGVTVGSKALKHFWKGVHYRWAFFMASGPCLDDIAELVDAGKIRPVIEQTFPFSKVPEAFLKVERGHARGKTVINVV

Rtn4ip1

Reticulon-4-interacting protein 1, mitochondrial

396 amino acids

Plays a role in the regulation of retinal ganglion cell (RGC) neurite outgrowth, and hence in the development of the inner retina and optic nerve (PubMed:26593267). Appears to be a potent inhibitor of regeneration following spinal cord injury (PubMed:12067236).

Belongs to the zinc-containing alcohol dehydrogenase family. Quinone oxidoreductase subfamily.

43.371 kDa

MGVLKTCVLRRSACAAACFWRRTVIPKPPFRGISTTSARSTVMPAWVIDKYGKNEVLRFTQNMMLPIIHYPNEVIIKVHAASVNPIDVNMRSGYGATALNMKRDPLHMKTKGEEFPLTLGRDVSGVVMECGLDVKYFQPGDEVWAAVPPWKQGTLSEFVVVSGNEVSHKPKSLTHTQAASLPYVALTAWSAINKVGGLSDKNCKGKRALILGASGGVGTFAIQVMKAWGAHVTAVCSKDASELVRKLGADEVIDYTLGSVEEQLKSLKLFDFILDNVGGSTETWALNFLKKWSGATYVTLVTPFLLNMDRLGVADGMLQTGVTVGTKALKHLWQGVHYRWAFFMASGPYLDEIAELVDAGKIRPVIERTFPFSEVPEAFLKVERGHARGKTVVNVV

rtn4ip1

Reticulon-4-interacting protein 1 homolog, mitochondrial

387 amino acids

Plays a role in the regulation of retinal ganglion cell (RGC) maturation, neurite outgrowth, and hence in the development of the inner retina and optic nerve (PubMed:26593267). Appears to be a potent inhibitor of regeneration following spinal cord injury (By similarity).

Belongs to the zinc-containing alcohol dehydrogenase family. Quinone oxidoreductase subfamily.

42.328 kDa

MLMCRRWLVCSLRCHYRSFSFSAARRTVMPAWVIDKYGKNDVLRFTKNAALPIIHYPNEVVVKVHAAGLNPIDISMRGGYGAATMAMKRDPLNISQSGGEFPLILGRDVSGEIMECGLDVKYFKPGDQVWAAIPPWKQGSLAEFVVVSGNEVSHKPKSLRHDEAASIPYVAATAWSAIVNTGGLNKDNSAKKRVLILGGSGGVGTFAIQMVKAWGAHVTVTCSQNAERLVRDLGADDVVDYTAGPVEKQLKNLEKFDLILDSIGGETEKWALDLLKPWSGAKFVTLITPFLQNTDRLGLADGMMQSAVTVGCKVVKNLRKGVHYRWGFFAPSGSALDEVSEMVDAGKVRPVVEEVFSFAQVPEAFQKVEQGHARGKTVVSIMEDQKE

rtn4ip1

Reticulon-4-interacting protein 1 homolog, mitochondrial

352 amino acids

Belongs to the zinc-containing alcohol dehydrogenase family. Quinone oxidoreductase subfamily.

39.332 kDa

MKGILLNGYGESLDLLEYKTDLPVPKPIKSQVLIKIHSTSINPLDNVMRKGYASSIVDLKLKLPIILGRECSGEIVEIGDSVWDYEIGDQVWSASPPFSMGSHCEYITVDESEISLKPKNLTHQQSASIPFASLTAWNAIYNVLPTNKKITTNTKILVNGGNGSVGFFILQLLKKHLNVNQVSTTCNIKHFEKLKKLTLVNETIDYNNLKINDNDNNKFDLIFNCYDGGKNQNENEKKCIDALKDGGNLIGFNGPLVKFSDKDGVLSGLPMGMMNQLNSSERIKKQYSKNVHLDYAIFSPSGSTLKQISKLYENNILIPNIDKQFNLNQIKDAYTCFENSNSNGKIIINNKF