About Products Protein Database Contact

RT0827

Gene
RT0827
Protein
UPF0235 protein RT0827
Organism
Rickettsia typhi (strain ATCC VR-144 / Wilmington)
Length
105 amino acids
Similarity
Belongs to the UPF0235 family.
Mass
12.198 kDa
Sequence
MNKFYIYNNFKNEALINIKVKPYSKQNLINNFVIINNIPYIKLSITAAPEQGKANEGIINYLAKEWKLSRSSIEIIKGHTHSLKTILIKNINEDYLNLIINSYIK